CCDC3 (coiled-coil domain containing 3)

Gene

• Entrez ID: 83643
• Gene name: Coiled-coil domain containing 3
• Gene symbol: CCDC3
• Synonyms (NCBI Gene): -
• Chromosome: 10
• Chromosome location: 10p13

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022206	hsa-miR-124-3p	Microarray	18668037
MIRT868812	hsa-miR-138	CLIP-seq
MIRT868813	hsa-miR-1972	CLIP-seq
MIRT868814	hsa-miR-3179	CLIP-seq
MIRT868815	hsa-miR-3202	CLIP-seq
MIRT868816	hsa-miR-3674	CLIP-seq
MIRT868817	hsa-miR-3978	CLIP-seq
MIRT868818	hsa-miR-4274	CLIP-seq
MIRT868819	hsa-miR-4476	CLIP-seq
MIRT868820	hsa-miR-4688	CLIP-seq
MIRT868821	hsa-miR-4694-5p	CLIP-seq
MIRT868822	hsa-miR-4768-5p	CLIP-seq
MIRT868823	hsa-miR-486-3p	CLIP-seq
MIRT868824	hsa-miR-622	CLIP-seq
MIRT868825	hsa-miR-651	CLIP-seq
MIRT868826	hsa-miR-885-3p	CLIP-seq
MIRT1957807	hsa-miR-1207-3p	CLIP-seq
MIRT1957808	hsa-miR-1236	CLIP-seq
MIRT1957809	hsa-miR-198	CLIP-seq
MIRT1957810	hsa-miR-2278	CLIP-seq
MIRT1957811	hsa-miR-3182	CLIP-seq
MIRT1957812	hsa-miR-3649	CLIP-seq
MIRT1957813	hsa-miR-455-3p	CLIP-seq
MIRT1957814	hsa-miR-520a-5p	CLIP-seq
MIRT1957815	hsa-miR-525-5p	CLIP-seq
MIRT1957816	hsa-miR-711	CLIP-seq
MIRT1957817	hsa-miR-888	CLIP-seq
MIRT2194843	hsa-miR-33a	CLIP-seq
MIRT2194844	hsa-miR-33b	CLIP-seq
MIRT2385638	hsa-miR-34b	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005576	Component	Extracellular region	IBA
GO:0005576	Component	Extracellular region	IDA	28827783
GO:0005576	Component	Extracellular region	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0007165	Process	Signal transduction	IDA	28827783
GO:0008610	Process	Lipid biosynthetic process	IEA
GO:0010629	Process	Negative regulation of gene expression	IBA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010804	Process	Negative regulation of tumor necrosis factor-mediated signaling pathway	IMP	25193116
GO:0045600	Process	Positive regulation of fat cell differentiation	IEA
GO:0045833	Process	Negative regulation of lipid metabolic process	IDA	28827783
GO:0046889	Process	Positive regulation of lipid biosynthetic process	IEA
GO:0051055	Process	Negative regulation of lipid biosynthetic process	IEA

Other IDs

• MIM: 620579
• HGNC: 23813
• e!Ensembl: ENSG00000151468

Protein

• UniProt ID: Q9BQI4
• Protein name: Coiled-coil domain-containing protein 3 (Fat/vessel-derived secretory protein) (Favine)
• Protein function: Negatively regulates TNF-alpha-induced pro-inflammatory response in endothelial cells (ECs) via inhibition of TNF-alpha-induced NF-kappaB activation in ECs (PubMed:25193116). Positively regulates lipid accumulation in adipose cells (By similarit
• Tissue specificity: TISSUE SPECIFICITY: Expressed in umbilical vein endothelial cells (HUVEC), and at lower levels in aortic smooth muscle cells (HASMC). {ECO:0000269|PubMed:20043878}.
• Sequence:

  MLRQLLLAALCLAGPPAPARACQLPSEWRPLSEGCRAELAETIVYARVLALHPEAPGLYN
  HLPWQYHAGQGGLFYSAEVEMLCDQAWGSMLEVPAGSRLNLTGLGYFSCHSHTVVQDYSY
  FFFLRMDENYNLLPHGVNFQDAIFPDTQENRRMFSSLFQFSNCSQGQQLATFSSDWEIQE
  DSRLMCSSVQKALFEEEDHVKKLQQKVATLEKRNRQLRERVKKVKRSLRQARKKGRHLEL
  ANQKLSEKLAAGALPHINARGPVRPPYLRG

• Sequence length: 270

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONNECTIVE TISSUE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lip and oral cavity carcinoma	association not found	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Neoplasms	Breast neoplasm	Pubtator	36647876	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31081073		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	31081073		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	33568476	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	31081073		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	31081073	Associate	★☆☆☆☆ Found in Text Mining only