Gene Gene information from NCBI Gene database.
Entrez ID 83636
Gene name Chromosome 19 open reading frame 12
Gene symbol C19orf12
Synonyms (NCBI Gene)
MPANNBIA3NBIA4SPG43
Chromosome 19
Chromosome location 19q12
Summary This gene encodes a small transmembrane protein. Mutations in this gene are a cause of neurodegeneration with brain iron accumulation-4 (NBIA4), but the specific function of the encoded protein is unknown. Alternatively spliced transcript variants encodin
SNPs SNP information provided by dbSNP.
19
SNP ID Visualize variation Clinical significance Consequence
rs146170087 T>C Uncertain-significance, conflicting-interpretations-of-pathogenicity, not-provided, pathogenic Missense variant, genic downstream transcript variant, 3 prime UTR variant, coding sequence variant
rs200133991 C>T Pathogenic, likely-pathogenic 5 prime UTR variant, genic downstream transcript variant, missense variant, coding sequence variant, intron variant
rs201118405 C>G,T Conflicting-interpretations-of-pathogenicity, benign, benign-likely-benign Synonymous variant, 5 prime UTR variant, genic downstream transcript variant, coding sequence variant, intron variant
rs201987973 G>A Pathogenic Genic downstream transcript variant, coding sequence variant, missense variant
rs376103979 C>G,T Pathogenic, likely-pathogenic 5 prime UTR variant, genic downstream transcript variant, missense variant, coding sequence variant, intron variant
miRNA miRNA information provided by mirtarbase database.
505
miRTarBase ID miRNA Experiments Reference
MIRT025866 hsa-miR-7-5p Sequencing 20371350
MIRT042283 hsa-miR-484 CLASH 23622248
MIRT549575 hsa-miR-5197-5p PAR-CLIP 21572407
MIRT549574 hsa-miR-5584-5p PAR-CLIP 21572407
MIRT549573 hsa-miR-6750-5p PAR-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15
GO ID Ontology Definition Evidence Reference
GO:0005737 Component Cytoplasm IEA
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IDA 23857908, 26136767
GO:0005739 Component Mitochondrion IEA
GO:0005783 Component Endoplasmic reticulum IDA 23857908, 26136767
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
614297 25443 ENSG00000131943
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NSK7
Protein name Protein C19orf12
Family and domains
Sequence
MERLKSHKPATMTIMVEDIMKLLCSLSGERKMKAAVKHSGKGALVTGAMAFVGGLVGGPP
GLAVGGAVGGLLGAWMTSGQFKPVPQILMELPPAEQQRLFNEAAAIIRHLEWTDAVQLTA
LVMGSEALQQQLLAMLVNYVTKELRAEIQYDD
Sequence length 152
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
35
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Abnormal central motor function Likely pathogenic; Pathogenic rs1568326754 RCV001814233
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Abnormality of iron homeostasis Likely pathogenic; Pathogenic rs397514477 RCV001004003
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Adult-onset night blindness Likely pathogenic; Pathogenic rs515726205 RCV000414809
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
C19orf12-related disorder Pathogenic; Likely pathogenic rs2513280986, rs515726204 RCV003984359
RCV003904862
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
AUTOSOMAL RECESSIVE SPASTIC PARAPLEGIA TYPE 43 Orphanet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BREAST CANCER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adult-onset night blindness Night Blindness CLINVAR_DG
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Amyotrophic Lateral Sclerosis Amyotrophic Lateral Sclerosis BEFREE 22584950, 28365006, 30553531
★☆☆☆☆
Found in Text Mining only
Anarthria speech disorder Anarthria Speech Disorder BEFREE 28641177
★☆☆☆☆
Found in Text Mining only
Autosomal Recessive Hereditary Spastic Paraplegia Spastic paraplegia BEFREE 26714052
★☆☆☆☆
Found in Text Mining only
Autosomal recessive spastic paraplegia type 43 Spastic Paraplegia Orphanet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Behr syndrome Abortive cerebellar ataxia BEFREE 26187298
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 22433433 Associate
★☆☆☆☆
Found in Text Mining only
Cerebellar Diseases Cerebellar diseases Pubtator 24361204 Associate
★☆☆☆☆
Found in Text Mining only
Deglutition Disorders Dysphagia HPO_DG
★☆☆☆☆
Found in Text Mining only
Dementia Dementia BEFREE 23269600, 31804703
★☆☆☆☆
Found in Text Mining only