Gene Gene information from NCBI Gene database.
Entrez ID 83604
Gene name Transmembrane protein 47
Gene symbol TMEM47
Synonyms (NCBI Gene)
BCMP1TM4SF10VAB-9
Chromosome X
Chromosome location Xp21.1
Summary This gene encodes a member of the PMP22/EMP/claudin protein family. The encoded protein is localized to the ER and the plasma membrane. In dogs, transcripts of this gene exist at high levels in the brain. [provided by RefSeq, Jul 2008]
SNPs SNP information provided by dbSNP.
1
SNP ID Visualize variation Clinical significance Consequence
rs1114167296 C>G Likely-pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
209
miRTarBase ID miRNA Experiments Reference
MIRT019348 hsa-miR-148b-3p Microarray 17612493
MIRT021761 hsa-miR-132-3p Microarray 17612493
MIRT551874 hsa-miR-5011-5p HITS-CLIP 21572407
MIRT551872 hsa-miR-511-3p HITS-CLIP 21572407
MIRT551871 hsa-miR-496 HITS-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183, 32814053
GO:0005886 Component Plasma membrane IDA
GO:0005911 Component Cell-cell junction IBA
GO:0005911 Component Cell-cell junction IEA
GO:0005912 Component Adherens junction IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300698 18515 ENSG00000147027
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BQJ4
Protein name Transmembrane protein 47 (Brain cell membrane protein 1) (Transmembrane 4 superfamily member 10)
Protein function Regulates cell junction organization in epithelial cells. May play a role in the transition from adherens junction to tight junction assembly. May regulate F-actin polymerization required for tight junctional localization dynamics and affect the
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in adult brain, fetal brain, cerebellum, heart, lung, prostate and thyroid. {ECO:0000269|PubMed:24603971}.
Sequence
MASAGSGMEEVRVSVLTPLKLVGLVCIFLALCLDLGAVLSPAWVTADHQYYLSLWESCRK
PASLDIWHCESTLSSDWQIATLALLLGGAAIILIAFLVGLISICVGSRRRFYRPVAVMLF
AAVVLQVCSLVLYPIKFIETVSLKIYHEFNWGYGLAWGATIFSFGGAILYCLNPKNYEDY
Y
Sequence length 181
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
5
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ATTENTION DEFICIT HYPERACTIVITY DISORDER Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CEREBELLAR ATROPHY Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DANDY-WALKER SYNDROME Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
GLOBAL DEVELOPMENTAL DELAY Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Attention deficit hyperactivity disorder Attention Deficit Hyperactivity Disorder CLINVAR_DG
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Brain Diseases Brain disease Pubtator 15345028 Associate
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 28944917, 33745390 Associate
★☆☆☆☆
Found in Text Mining only
Cerebellar atrophy Cerebellar atrophy CLINVAR_DG
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Dandy-Walker Syndrome Dandy-Walker Syndrome CLINVAR_DG
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Developmental Disabilities Developmental disability Pubtator 24603971 Associate
★☆☆☆☆
Found in Text Mining only
Global developmental delay Developmental Delay CLINVAR_DG
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Hypoplasia of corpus callosum Hypoplasia Of Corpus Callosum CLINVAR_DG
★☆☆☆☆
Found in Text Mining only
Melanoma Melanoma Pubtator 21606880 Associate
★☆☆☆☆
Found in Text Mining only
Mental Retardation, X-Linked Mental retardation BEFREE 15345028
★☆☆☆☆
Found in Text Mining only