CASP3 (caspase 3)

Gene

• Entrez ID: 836
• Gene name: Caspase 3
• Gene symbol: CASP3
• Synonyms (NCBI Gene): CPP32, CPP32B, SCA-1
• Chromosome: 4
• Chromosome location: 4q35.1
• Summary: The protein encoded by this gene is a cysteine-aspartic acid protease that plays a central role in the execution-phase of cell apoptosis. The encoded protein cleaves and inactivates poly(ADP-ribose) polymerase while it cleaves and activates sterol regulat

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003574	hsa-miR-98-5p	Review	19815577
MIRT005292	hsa-let-7a-5p	Luciferase reporter assay, Western blot	18758960
MIRT005292	hsa-let-7a-5p	Luciferase reporter assay, Western blot	18758960
MIRT006240	hsa-miR-30d-5p	Luciferase reporter assay, Western blot	22058146
MIRT006240	hsa-miR-30d-5p	Luciferase reporter assay, Western blot	22058146
MIRT006240	hsa-miR-30d-5p	Luciferase reporter assay, Western blot	22058146
MIRT006864	hsa-miR-138-5p	Luciferase reporter assay	22921398
MIRT019884	hsa-miR-375	qRT-PCR;Microarray	20584986
MIRT021992	hsa-miR-128-3p	Sequencing	20371350
MIRT024157	hsa-miR-221-3p	Sequencing	20371350
MIRT029617	hsa-miR-26b-5p	Microarray	19088304
MIRT048249	hsa-miR-196a-5p	CLASH	23622248
MIRT054129	hsa-miR-421	qRT-PCR, Western blot	25041019
MIRT438878	hsa-miR-885-5p	Luciferase reporter assay	23271051
MIRT438878	hsa-miR-885-5p	Luciferase reporter assay	23271051
MIRT438878	hsa-miR-885-5p	Luciferase reporter assay	23271051
MIRT438730	hsa-miR-363-3p	and NCH441"	24805821
MIRT438730	hsa-miR-363-3p	and NCH441"	24805821
MIRT438729	hsa-miR-582-5p	and NCH441"	24805821
MIRT438729	hsa-miR-582-5p	and NCH441"	24805821
MIRT438878	hsa-miR-885-5p	Luciferase reporter assay	23271051
MIRT438878	hsa-miR-885-5p	Luciferase reporter assay	23271051
MIRT438878	hsa-miR-885-5p	Luciferase reporter assay	23271051
MIRT438730	hsa-miR-363-3p	and NCH441"	24805821
MIRT438730	hsa-miR-363-3p	and NCH441"	24805821
MIRT438729	hsa-miR-582-5p	and NCH441"	24805821
MIRT438729	hsa-miR-582-5p	and NCH441"	24805821
MIRT487458	hsa-miR-548n	PAR-CLIP	23592263
MIRT164579	hsa-miR-651-3p	PAR-CLIP	23592263
MIRT487457	hsa-miR-562	PAR-CLIP	23592263
MIRT487456	hsa-miR-888-5p	PAR-CLIP	23592263
MIRT487455	hsa-miR-6076	PAR-CLIP	23592263
MIRT487454	hsa-miR-6797-3p	PAR-CLIP	23592263
MIRT164595	hsa-miR-6124	PAR-CLIP	23592263
MIRT487453	hsa-miR-5011-3p	PAR-CLIP	23592263
MIRT487452	hsa-miR-4666b	PAR-CLIP	23592263
MIRT487451	hsa-miR-3680-3p	PAR-CLIP	23592263
MIRT441002	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT441003	hsa-miR-382-5p	HITS-CLIP	24374217
MIRT728049	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT728050	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT437365	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT006240	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT728048	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT441002	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT441003	hsa-miR-382-5p	HITS-CLIP	24374217
MIRT003574	hsa-miR-98-5p	Luciferase reporter assay, qRT-PCR, Western blot	26367177
MIRT054129	hsa-miR-421	Luciferase reporter assay	27016414
MIRT054129	hsa-miR-421	Luciferase reporter assay	27016414
MIRT728048	hsa-miR-30e-5p	Luciferase reporter assay	26895377
MIRT728048	hsa-miR-30e-5p	Luciferase reporter assay	26895377
MIRT356254	hsa-let-7b-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26296645
MIRT732067	hsa-miR-224-5p	Luciferase reporter assay, Western blot	26307684
MIRT732067	hsa-miR-224-5p	Luciferase reporter assay, Western blot	26307684
MIRT054129	hsa-miR-421	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27016414
MIRT054129	hsa-miR-421	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27016414
MIRT732590	hsa-miR-133a-3p	Immunofluorescence, qRT-PCR, Western blotting	33639970
MIRT734060	hsa-miR-612	qRT-PCR	33564285
MIRT006864	hsa-miR-138-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry	33856081
MIRT734992	hsa-let-7e-3p	qRT-PCR	33066614
MIRT735171	hsa-miR-7-5p	Microarray, qRT-PCR	33468167
MIRT735254	hsa-miR-30d-3p	Microarray, qRT-PCR	32407273
MIRT006864	hsa-miR-138-5p	Western blotting, qRT-PCR	32388607
MIRT006864	hsa-miR-138-5p	Western blotting, qRT-PCR	32388607
MIRT487458	hsa-miR-548n	PAR-CLIP	23592263
MIRT164579	hsa-miR-651-3p	PAR-CLIP	23592263
MIRT487457	hsa-miR-562	PAR-CLIP	23592263
MIRT487456	hsa-miR-888-5p	PAR-CLIP	23592263
MIRT487455	hsa-miR-6076	PAR-CLIP	23592263
MIRT487454	hsa-miR-6797-3p	PAR-CLIP	23592263
MIRT164595	hsa-miR-6124	PAR-CLIP	23592263
MIRT487453	hsa-miR-5011-3p	PAR-CLIP	23592263
MIRT487452	hsa-miR-4666b	PAR-CLIP	23592263
MIRT487451	hsa-miR-3680-3p	PAR-CLIP	23592263
MIRT755542	hsa-miR-181c-5p	Western blotting, qRT-PCR	36676955
MIRT755862	hsa-miR-107	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry, ELISA	38828010
MIRT755862	hsa-miR-107	Immunoprecipitaion (IP)	36816358
MIRT756319	hsa-miR-29b-1-5p	Western blotting, Immunofluorescence	38934067
MIRT756379	hsa-miR-139-5p	Western blotting	37794118
MIRT864029	hsa-miR-1304	CLIP-seq
MIRT864030	hsa-miR-137	CLIP-seq
MIRT864031	hsa-miR-1825	CLIP-seq
MIRT864032	hsa-miR-197	CLIP-seq
MIRT864033	hsa-miR-3152-5p	CLIP-seq
MIRT864034	hsa-miR-4760-3p	CLIP-seq
MIRT864035	hsa-miR-4789-3p	CLIP-seq
MIRT864036	hsa-miR-891b	CLIP-seq
MIRT864037	hsa-miR-103a	CLIP-seq
MIRT755862	hsa-miR-107	CLIP-seq
MIRT864038	hsa-miR-1184	CLIP-seq
MIRT864039	hsa-miR-1205	CLIP-seq
MIRT864040	hsa-miR-1287	CLIP-seq
MIRT864030	hsa-miR-137	CLIP-seq
MIRT864032	hsa-miR-197	CLIP-seq
MIRT864041	hsa-miR-24	CLIP-seq
MIRT864033	hsa-miR-3152-5p	CLIP-seq
MIRT864042	hsa-miR-3158-5p	CLIP-seq
MIRT864043	hsa-miR-3176	CLIP-seq
MIRT864044	hsa-miR-3202	CLIP-seq
MIRT864045	hsa-miR-3616-3p	CLIP-seq
MIRT864046	hsa-miR-3652	CLIP-seq
MIRT864047	hsa-miR-3658	CLIP-seq
MIRT864048	hsa-miR-3662	CLIP-seq
MIRT864049	hsa-miR-376c	CLIP-seq
MIRT864050	hsa-miR-3922-3p	CLIP-seq
MIRT864051	hsa-miR-4430	CLIP-seq
MIRT864052	hsa-miR-4437	CLIP-seq
MIRT864053	hsa-miR-4533	CLIP-seq
MIRT864054	hsa-miR-455-5p	CLIP-seq
MIRT864055	hsa-miR-4662a-3p	CLIP-seq
MIRT864056	hsa-miR-4693-3p	CLIP-seq
MIRT864057	hsa-miR-4698	CLIP-seq
MIRT864058	hsa-miR-4712-3p	CLIP-seq
MIRT864059	hsa-miR-4721	CLIP-seq
MIRT864060	hsa-miR-4757-5p	CLIP-seq
MIRT864061	hsa-miR-4773	CLIP-seq
MIRT864062	hsa-miR-518d-5p	CLIP-seq
MIRT864063	hsa-miR-519b-5p	CLIP-seq
MIRT864064	hsa-miR-519c-5p	CLIP-seq
MIRT864065	hsa-miR-520c-5p	CLIP-seq
MIRT864066	hsa-miR-526a	CLIP-seq
MIRT864067	hsa-miR-548a-5p	CLIP-seq
MIRT864068	hsa-miR-548ab	CLIP-seq
MIRT864069	hsa-miR-548ak	CLIP-seq
MIRT864070	hsa-miR-548b-5p	CLIP-seq
MIRT864071	hsa-miR-548c-5p	CLIP-seq
MIRT864072	hsa-miR-548d-5p	CLIP-seq
MIRT864073	hsa-miR-548h	CLIP-seq
MIRT864074	hsa-miR-548i	CLIP-seq
MIRT864075	hsa-miR-548j	CLIP-seq
MIRT864076	hsa-miR-548k	CLIP-seq
MIRT864077	hsa-miR-548l	CLIP-seq
MIRT864078	hsa-miR-548w	CLIP-seq
MIRT864079	hsa-miR-548y	CLIP-seq
MIRT864080	hsa-miR-559	CLIP-seq
MIRT864081	hsa-miR-603	CLIP-seq
MIRT864082	hsa-miR-654-3p	CLIP-seq
MIRT1546174	hsa-let-7a	CLIP-seq
MIRT1546175	hsa-let-7b	CLIP-seq
MIRT1546176	hsa-let-7c	CLIP-seq
MIRT1546177	hsa-let-7d	CLIP-seq
MIRT1546178	hsa-let-7e	CLIP-seq
MIRT1546179	hsa-let-7f	CLIP-seq
MIRT1546180	hsa-let-7g	CLIP-seq
MIRT1546181	hsa-let-7i	CLIP-seq
MIRT864029	hsa-miR-1304	CLIP-seq
MIRT1546182	hsa-miR-138	CLIP-seq
MIRT1546183	hsa-miR-140-5p	CLIP-seq
MIRT1546184	hsa-miR-202	CLIP-seq
MIRT1546185	hsa-miR-3545-5p	CLIP-seq
MIRT1546186	hsa-miR-376a	CLIP-seq
MIRT1546187	hsa-miR-376b	CLIP-seq
MIRT1546188	hsa-miR-4458	CLIP-seq
MIRT1546189	hsa-miR-4460	CLIP-seq
MIRT1546190	hsa-miR-4500	CLIP-seq
MIRT1546191	hsa-miR-98	CLIP-seq
MIRT1556132	hsa-miR-369-3p	CLIP-seq
MIRT1556133	hsa-miR-374a	CLIP-seq
MIRT1556134	hsa-miR-374b	CLIP-seq
MIRT1556135	hsa-miR-3942-3p	CLIP-seq
MIRT1556136	hsa-miR-410	CLIP-seq
MIRT756379	hsa-miR-139-5p	CLIP-seq
MIRT864047	hsa-miR-3658	CLIP-seq
MIRT864055	hsa-miR-4662a-3p	CLIP-seq
MIRT1956145	hsa-miR-4666-5p	CLIP-seq
MIRT1956146	hsa-miR-4795-3p	CLIP-seq
MIRT1956147	hsa-miR-5095	CLIP-seq
MIRT1956148	hsa-miR-514	CLIP-seq
MIRT1956149	hsa-miR-514b-3p	CLIP-seq
MIRT1956150	hsa-miR-601	CLIP-seq
MIRT864081	hsa-miR-603	CLIP-seq
MIRT1546182	hsa-miR-138	CLIP-seq
MIRT864034	hsa-miR-4760-3p	CLIP-seq
MIRT864037	hsa-miR-103a	CLIP-seq
MIRT755862	hsa-miR-107	CLIP-seq
MIRT2193795	hsa-miR-1229	CLIP-seq
MIRT2193796	hsa-miR-203	CLIP-seq
MIRT2193797	hsa-miR-2277-3p	CLIP-seq
MIRT2193798	hsa-miR-3614-5p	CLIP-seq
MIRT2193799	hsa-miR-3660	CLIP-seq
MIRT2193800	hsa-miR-3672	CLIP-seq
MIRT2193801	hsa-miR-3977	CLIP-seq
MIRT2193802	hsa-miR-4526	CLIP-seq
MIRT2193803	hsa-miR-4642	CLIP-seq
MIRT2193804	hsa-miR-4676-5p	CLIP-seq
MIRT864058	hsa-miR-4712-3p	CLIP-seq
MIRT864034	hsa-miR-4760-3p	CLIP-seq
MIRT2193805	hsa-miR-550b	CLIP-seq
MIRT2193806	hsa-miR-566	CLIP-seq
MIRT2193807	hsa-miR-575	CLIP-seq
MIRT2193808	hsa-miR-652	CLIP-seq
MIRT864082	hsa-miR-654-3p	CLIP-seq
MIRT2193809	hsa-miR-885-3p	CLIP-seq
MIRT2193810	hsa-miR-890	CLIP-seq
MIRT2193811	hsa-miR-942	CLIP-seq
MIRT2385555	hsa-miR-513b	CLIP-seq
MIRT2427045	hsa-miR-23a	CLIP-seq
MIRT2427046	hsa-miR-23b	CLIP-seq
MIRT2427047	hsa-miR-23c	CLIP-seq
MIRT2427048	hsa-miR-323-3p	CLIP-seq
MIRT2427049	hsa-miR-337-3p	CLIP-seq
MIRT2427050	hsa-miR-382	CLIP-seq
MIRT2427051	hsa-miR-4326	CLIP-seq
MIRT2427052	hsa-miR-4709-5p	CLIP-seq
MIRT2427053	hsa-miR-4794	CLIP-seq
MIRT2427054	hsa-miR-619	CLIP-seq
MIRT2446205	hsa-miR-144	CLIP-seq
MIRT2446206	hsa-miR-30a	CLIP-seq
MIRT2446207	hsa-miR-30b	CLIP-seq
MIRT2446208	hsa-miR-30c	CLIP-seq
MIRT2446209	hsa-miR-30d	CLIP-seq
MIRT2446210	hsa-miR-30e	CLIP-seq
MIRT2496952	hsa-miR-1254	CLIP-seq
MIRT2496953	hsa-miR-1256	CLIP-seq
MIRT2496954	hsa-miR-1283	CLIP-seq
MIRT864040	hsa-miR-1287	CLIP-seq
MIRT1546182	hsa-miR-138	CLIP-seq
MIRT2446205	hsa-miR-144	CLIP-seq
MIRT2496955	hsa-miR-153	CLIP-seq
MIRT2496956	hsa-miR-190	CLIP-seq
MIRT2496957	hsa-miR-190b	CLIP-seq
MIRT2496958	hsa-miR-221	CLIP-seq
MIRT2496959	hsa-miR-222	CLIP-seq
MIRT2193797	hsa-miR-2277-3p	CLIP-seq
MIRT864041	hsa-miR-24	CLIP-seq
MIRT2496960	hsa-miR-29a	CLIP-seq
MIRT2496961	hsa-miR-29b	CLIP-seq
MIRT2496962	hsa-miR-29c	CLIP-seq
MIRT2446206	hsa-miR-30a	CLIP-seq
MIRT2446207	hsa-miR-30b	CLIP-seq
MIRT2446208	hsa-miR-30c	CLIP-seq
MIRT2446209	hsa-miR-30d	CLIP-seq
MIRT2446210	hsa-miR-30e	CLIP-seq
MIRT2496963	hsa-miR-3116	CLIP-seq
MIRT2496964	hsa-miR-3145-3p	CLIP-seq
MIRT864033	hsa-miR-3152-5p	CLIP-seq
MIRT2496965	hsa-miR-3163	CLIP-seq
MIRT864043	hsa-miR-3176	CLIP-seq
MIRT2496966	hsa-miR-320a	CLIP-seq
MIRT2496967	hsa-miR-320b	CLIP-seq
MIRT2496968	hsa-miR-320c	CLIP-seq
MIRT2496969	hsa-miR-320d	CLIP-seq
MIRT2496970	hsa-miR-342-3p	CLIP-seq
MIRT2496971	hsa-miR-3529	CLIP-seq
MIRT2496972	hsa-miR-3607-3p	CLIP-seq
MIRT2496973	hsa-miR-3614-3p	CLIP-seq
MIRT864045	hsa-miR-3616-3p	CLIP-seq
MIRT864046	hsa-miR-3652	CLIP-seq
MIRT2193800	hsa-miR-3672	CLIP-seq
MIRT2496974	hsa-miR-370	CLIP-seq
MIRT2496975	hsa-miR-379	CLIP-seq
MIRT864050	hsa-miR-3922-3p	CLIP-seq
MIRT2496976	hsa-miR-4254	CLIP-seq
MIRT2496977	hsa-miR-4317	CLIP-seq
MIRT2496978	hsa-miR-4429	CLIP-seq
MIRT864051	hsa-miR-4430	CLIP-seq
MIRT864052	hsa-miR-4437	CLIP-seq
MIRT2496979	hsa-miR-4451	CLIP-seq
MIRT2496980	hsa-miR-4532	CLIP-seq
MIRT864054	hsa-miR-455-5p	CLIP-seq
MIRT2496981	hsa-miR-4639-5p	CLIP-seq
MIRT2496982	hsa-miR-4649-3p	CLIP-seq
MIRT2496983	hsa-miR-4650-3p	CLIP-seq
MIRT2496984	hsa-miR-4656	CLIP-seq
MIRT2496985	hsa-miR-4663	CLIP-seq
MIRT2193804	hsa-miR-4676-5p	CLIP-seq
MIRT2496986	hsa-miR-4685-5p	CLIP-seq
MIRT2496987	hsa-miR-4688	CLIP-seq
MIRT864059	hsa-miR-4721	CLIP-seq
MIRT2496988	hsa-miR-4728-3p	CLIP-seq
MIRT864060	hsa-miR-4757-5p	CLIP-seq
MIRT2496989	hsa-miR-4763-5p	CLIP-seq
MIRT2496990	hsa-miR-4768-5p	CLIP-seq
MIRT1956146	hsa-miR-4795-3p	CLIP-seq
MIRT2496991	hsa-miR-491-3p	CLIP-seq
MIRT2496992	hsa-miR-513c	CLIP-seq
MIRT2496993	hsa-miR-514b-5p	CLIP-seq
MIRT864062	hsa-miR-518d-5p	CLIP-seq
MIRT864063	hsa-miR-519b-5p	CLIP-seq
MIRT864064	hsa-miR-519c-5p	CLIP-seq
MIRT864065	hsa-miR-520c-5p	CLIP-seq
MIRT2496994	hsa-miR-520d-5p	CLIP-seq
MIRT2496995	hsa-miR-524-5p	CLIP-seq
MIRT864066	hsa-miR-526a	CLIP-seq
MIRT2496996	hsa-miR-548a-3p	CLIP-seq
MIRT2496997	hsa-miR-548e	CLIP-seq
MIRT2496998	hsa-miR-548f	CLIP-seq
MIRT2496999	hsa-miR-548t	CLIP-seq
MIRT2497000	hsa-miR-548v	CLIP-seq
MIRT2193807	hsa-miR-575	CLIP-seq
MIRT2497001	hsa-miR-586	CLIP-seq
MIRT2497002	hsa-miR-596	CLIP-seq
MIRT2497003	hsa-miR-600	CLIP-seq
MIRT2496952	hsa-miR-1254	CLIP-seq
MIRT2496953	hsa-miR-1256	CLIP-seq
MIRT864040	hsa-miR-1287	CLIP-seq
MIRT1546182	hsa-miR-138	CLIP-seq
MIRT2496955	hsa-miR-153	CLIP-seq
MIRT2496956	hsa-miR-190	CLIP-seq
MIRT2496957	hsa-miR-190b	CLIP-seq
MIRT2193797	hsa-miR-2277-3p	CLIP-seq
MIRT864041	hsa-miR-24	CLIP-seq
MIRT2496960	hsa-miR-29a	CLIP-seq
MIRT2496961	hsa-miR-29b	CLIP-seq
MIRT2496962	hsa-miR-29c	CLIP-seq
MIRT2496963	hsa-miR-3116	CLIP-seq
MIRT2496964	hsa-miR-3145-3p	CLIP-seq
MIRT2496965	hsa-miR-3163	CLIP-seq
MIRT864043	hsa-miR-3176	CLIP-seq
MIRT2496966	hsa-miR-320a	CLIP-seq
MIRT2496967	hsa-miR-320b	CLIP-seq
MIRT2496968	hsa-miR-320c	CLIP-seq
MIRT2496969	hsa-miR-320d	CLIP-seq
MIRT2496970	hsa-miR-342-3p	CLIP-seq
MIRT2496971	hsa-miR-3529	CLIP-seq
MIRT2496972	hsa-miR-3607-3p	CLIP-seq
MIRT2496973	hsa-miR-3614-3p	CLIP-seq
MIRT864045	hsa-miR-3616-3p	CLIP-seq
MIRT864046	hsa-miR-3652	CLIP-seq
MIRT2193800	hsa-miR-3672	CLIP-seq
MIRT2496974	hsa-miR-370	CLIP-seq
MIRT2496975	hsa-miR-379	CLIP-seq
MIRT864050	hsa-miR-3922-3p	CLIP-seq
MIRT2496976	hsa-miR-4254	CLIP-seq
MIRT2496977	hsa-miR-4317	CLIP-seq
MIRT2496978	hsa-miR-4429	CLIP-seq
MIRT864051	hsa-miR-4430	CLIP-seq
MIRT864052	hsa-miR-4437	CLIP-seq
MIRT2496979	hsa-miR-4451	CLIP-seq
MIRT2496980	hsa-miR-4532	CLIP-seq
MIRT864054	hsa-miR-455-5p	CLIP-seq
MIRT2496981	hsa-miR-4639-5p	CLIP-seq
MIRT2496982	hsa-miR-4649-3p	CLIP-seq
MIRT2496983	hsa-miR-4650-3p	CLIP-seq
MIRT2496984	hsa-miR-4656	CLIP-seq
MIRT2496985	hsa-miR-4663	CLIP-seq
MIRT2193804	hsa-miR-4676-5p	CLIP-seq
MIRT2496986	hsa-miR-4685-5p	CLIP-seq
MIRT2496987	hsa-miR-4688	CLIP-seq
MIRT864059	hsa-miR-4721	CLIP-seq
MIRT2496988	hsa-miR-4728-3p	CLIP-seq
MIRT864060	hsa-miR-4757-5p	CLIP-seq
MIRT2496989	hsa-miR-4763-5p	CLIP-seq
MIRT2496990	hsa-miR-4768-5p	CLIP-seq
MIRT1956146	hsa-miR-4795-3p	CLIP-seq
MIRT2496991	hsa-miR-491-3p	CLIP-seq
MIRT2496992	hsa-miR-513c	CLIP-seq
MIRT2496993	hsa-miR-514b-5p	CLIP-seq
MIRT864062	hsa-miR-518d-5p	CLIP-seq
MIRT864063	hsa-miR-519b-5p	CLIP-seq
MIRT864064	hsa-miR-519c-5p	CLIP-seq
MIRT864065	hsa-miR-520c-5p	CLIP-seq
MIRT864066	hsa-miR-526a	CLIP-seq
MIRT2496996	hsa-miR-548a-3p	CLIP-seq
MIRT2496997	hsa-miR-548e	CLIP-seq
MIRT2496998	hsa-miR-548f	CLIP-seq
MIRT2193807	hsa-miR-575	CLIP-seq
MIRT2497001	hsa-miR-586	CLIP-seq
MIRT2497002	hsa-miR-596	CLIP-seq
MIRT2497003	hsa-miR-600	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ING1	Activation	15662138
ING4	Activation	19895734
NFKB1	Unknown	20056115
PHF10	Unknown	20530714
PML	Activation	16253165
RELA	Unknown	20056115
RUNX3	Activation	15930301;19290488
SIM2	Activation	21729534
SP1	Unknown	11773055
TP53	Unknown	21859835

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001554	Process	Luteolysis	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0001782	Process	B cell homeostasis	IEA
GO:0001818	Process	Negative regulation of cytokine production	IMP	36002459
GO:0002020	Function	Protease binding	IEA
GO:0004175	Function	Endopeptidase activity	IEA
GO:0004190	Function	Aspartic-type endopeptidase activity	IEA
GO:0004197	Function	Cysteine-type endopeptidase activity	IBA
GO:0004197	Function	Cysteine-type endopeptidase activity	IDA	9334240, 16374543, 16920334, 17823127, 18723680, 19240112, 20566630, 21726810, 23650375, 23729654, 24904167, 28459430, 30878284, 33725486, 33852854, 35594856, 36002459, 37327784
GO:0004197	Function	Cysteine-type endopeptidase activity	IEA
GO:0004197	Function	Cysteine-type endopeptidase activity	IMP	10921886, 17559062, 21980415, 22253444
GO:0004197	Function	Cysteine-type endopeptidase activity	TAS	10942389
GO:0004861	Function	Cyclin-dependent protein serine/threonine kinase inhibitor activity	IEA
GO:0005123	Function	Death receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	7596430, 9208847, 9736630, 11257232, 15246877, 16227597, 16501604, 16530191, 17167422, 17544405, 17606900, 17823127, 18723680, 19273858, 21726810, 23150525, 25241761, 28514442, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IDA	16374543
GO:0005634	Component	Nucleus	IDA	17167422
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	17167422
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	17167422, 17823127, 22253444
GO:0005829	Component	Cytosol	TAS
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IDA	12888622, 17553422
GO:0006508	Process	Proteolysis	IEA
GO:0006915	Process	Apoptotic process	IBA
GO:0006915	Process	Apoptotic process	IDA	34480022
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	IMP	15565177
GO:0006915	Process	Apoptotic process	TAS	7983002
GO:0006974	Process	DNA damage response	IEA
GO:0007413	Process	Axonal fasciculation	IEA
GO:0007507	Process	Heart development	IEA
GO:0007605	Process	Sensory perception of sound	IEA
GO:0007611	Process	Learning or memory	IEA
GO:0008047	Function	Enzyme activator activity	IBA
GO:0008233	Function	Peptidase activity	IDA	9353287, 17167422, 19740745
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0008627	Process	Intrinsic apoptotic signaling pathway in response to osmotic stress	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009411	Process	Response to UV	IEA
GO:0009611	Process	Response to wounding	IEA
GO:0009749	Process	Response to glucose	IEA
GO:0010038	Process	Response to metal ion	IEA
GO:0010165	Process	Response to X-ray	IEA
GO:0014069	Component	Postsynaptic density	IEA
GO:0016005	Function	Phospholipase A2 activator activity	IEA
GO:0016241	Process	Regulation of macroautophagy	TAS	19549685
GO:0016485	Process	Protein processing	IDA	9334240
GO:0016485	Process	Protein processing	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0021766	Process	Hippocampus development	IEA
GO:0030163	Process	Protein catabolic process	IDA	16374543
GO:0030163	Process	Protein catabolic process	IEA
GO:0030182	Process	Neuron differentiation	IBA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030216	Process	Keratinocyte differentiation	IBA
GO:0030216	Process	Keratinocyte differentiation	IEA
GO:0030218	Process	Erythrocyte differentiation	IBA
GO:0030218	Process	Erythrocyte differentiation	IDA	17167422
GO:0030218	Process	Erythrocyte differentiation	TAS	18309324
GO:0030220	Process	Platelet formation	TAS	18309324
GO:0030889	Process	Negative regulation of B cell proliferation	IEA
GO:0031264	Component	Death-inducing signaling complex	IBA
GO:0031264	Component	Death-inducing signaling complex	IEA
GO:0031647	Process	Regulation of protein stability	IDA	17553422
GO:0031647	Process	Regulation of protein stability	IEA
GO:0032025	Process	Response to cobalt ion	IEA
GO:0032355	Process	Response to estradiol	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0034349	Process	Glial cell apoptotic process	IEA
GO:0034349	Process	Glial cell apoptotic process	IEA
GO:0034612	Process	Response to tumor necrosis factor	TAS	10521396
GO:0035094	Process	Response to nicotine	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035655	Process	Interleukin-18-mediated signaling pathway	IDA	14528293
GO:0042542	Process	Response to hydrogen peroxide	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043029	Process	T cell homeostasis	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043200	Process	Response to amino acid	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	IBA
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0044346	Process	Fibroblast apoptotic process	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045165	Process	Cell fate commitment	IEA
GO:0045786	Process	Negative regulation of cell cycle	IEA
GO:0046007	Process	Negative regulation of activated T cell proliferation	IEA
GO:0048011	Process	Neurotrophin TRK receptor signaling pathway	IDA	23954828
GO:0051146	Process	Striated muscle cell differentiation	IEA
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051604	Process	Protein maturation	IDA	28459430, 33852854, 35594856
GO:0051604	Process	Protein maturation	IEA
GO:0061713	Process	Anterior neural tube closure	IEA
GO:0070212	Process	Protein poly-ADP-ribosylation	IDA	33186521
GO:0070269	Process	Pyroptotic inflammatory response	IDA	28459430, 33852854, 35594856
GO:0070269	Process	Pyroptotic inflammatory response	IDA	36426955
GO:0071887	Process	Leukocyte apoptotic process	IEA
GO:0072347	Process	Response to anesthetic	IEA
GO:0072734	Process	Cellular response to staurosporine	IEA
GO:0072734	Process	Cellular response to staurosporine	IMP	22253444
GO:0097190	Process	Apoptotic signaling pathway	TAS	10521396
GO:0097193	Process	Intrinsic apoptotic signaling pathway	IMP	15565177
GO:0097194	Process	Execution phase of apoptosis	IBA
GO:0097194	Process	Execution phase of apoptosis	IDA	8689682, 16374543
GO:0097194	Process	Execution phase of apoptosis	IEA
GO:0097194	Process	Execution phase of apoptosis	IGI	12107093
GO:0097194	Process	Execution phase of apoptosis	IMP	11350920
GO:0098693	Process	Regulation of synaptic vesicle cycle	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0140639	Process	Positive regulation of pyroptotic inflammatory response	IDA	28459430, 33852854, 35594856
GO:1902004	Process	Positive regulation of amyloid-beta formation	IDA	17553422
GO:1902004	Process	Positive regulation of amyloid-beta formation	IEA
GO:1904019	Process	Epithelial cell apoptotic process	IEA

Other IDs

• MIM: 600636
• HGNC: 1504
• e!Ensembl: ENSG00000164305

Protein

• UniProt ID: P42574
• Protein name: Caspase-3 (CASP-3) (EC 3.4.22.56) (Apopain) (Cysteine protease CPP32) (CPP-32) (Protein Yama) (SREBP cleavage activity 1) (SCA-1) [Cleaved into: Caspase-3 subunit p17; Caspase-3 subunit p12]
• Protein function: Thiol protease that acts as a major effector caspase involved in the execution phase of apoptosis (PubMed:18723680, PubMed:20566630, PubMed:23650375, PubMed:35338844, PubMed:35446120, PubMed:7596430). Following cleavage and activation by initiat
• PDB: 1CP3, 1GFW, 1I3O, 1NME, 1NMQ, 1NMS, 1PAU, 1QX3, 1RE1, 1RHJ, 1RHK, 1RHM, 1RHQ, 1RHR, 1RHU, 2C1E, 2C2K, 2C2M, 2C2O, 2CDR, 2CJX, 2CJY, 2CNK, 2CNL, 2CNN, 2CNO, 2DKO, 2H5I, 2H5J, 2H65, 2J30, 2J31, 2J32, 2J33, 2XYG, 2XYH, 2XYP, 2XZD, 2XZT, 2Y0B, 3DEH, 3DEI, 3DEJ, 3DEK, 3EDQ, 3GJQ, 3GJR, 3GJS, 3GJT, 3H0E, 3ITN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00656	Peptidase_C14	45 → 275		Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in lung, spleen, heart, liver and kidney. Moderate levels in brain and skeletal muscle, and low in testis. Also found in many cell lines, highest expression in cells of the immune system. {ECO:0000269|PubMed:7983002}.
• Sequence:

  MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTG
  MTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLS
  HGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDD
  DMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVN
  RKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH

• Sequence length: 277

Pathways

KEGG:

Platinum drug resistance
MAPK signaling pathway
p53 signaling pathway
Efferocytosis
Apoptosis
Apoptosis - multiple species
Cytosolic DNA-sensing pathway
Natural killer cell mediated cytotoxicity
IL-17 signaling pathway
TNF signaling pathway
Serotonergic synapse
Non-alcoholic fatty liver disease
AGE-RAGE signaling pathway in diabetic complications
Alcoholic liver disease
Alzheimer disease
Parkinson disease
Amyotrophic lateral sclerosis
Huntington disease
Prion disease
Pathways of neurodegeneration - multiple diseases
Epithelial cell signaling in Helicobacter pylori infection
Pathogenic Escherichia coli infection
Salmonella infection
Pertussis
Legionellosis
Toxoplasmosis
Amoebiasis
Tuberculosis
Hepatitis C
Hepatitis B
Measles
Human cytomegalovirus infection
Influenza A
Human papillomavirus infection
Kaposi sarcoma-associated herpesvirus infection
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Human immunodeficiency virus 1 infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
MicroRNAs in cancer
Colorectal cancer
Small cell lung cancer
Viral myocarditis
Lipid and atherosclerosis

Reactome:

Activation of caspases through apoptosome-mediated cleavage
Apoptotic cleavage of cellular proteins
SMAC, XIAP-regulated apoptotic response
Apoptosis induced DNA fragmentation
Signaling by Hippo
NADE modulates death signalling
Caspase-mediated cleavage of cytoskeletal proteins
Apoptotic cleavage of cell adhesion proteins
Caspase activation via Dependence Receptors in the absence of ligand
Other interleukin signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CALCINOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL HEMORRHAGE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LEFT-SIDED ULCERATIVE COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS, ULCERATIVE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COPPER-OVERLOAD CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRYPTORCHIDISM	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC ANGIOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEUROPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC PERIPHERAL ANGIOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EDEMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART VALVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART VALVE DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART VALVE PROLAPSE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS, CHRONIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MUCOCUTANEOUS LYMPH NODE SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NERVOUS SYSTEM DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NERVOUS SYSTEM DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINAL DETACHMENT	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEPSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STATUS EPILEPTICUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Abdominal Cryptorchidism	Cryptorchidism	CTD_human_DG	26050606		★☆☆☆☆ Found in Text Mining only
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	18077176		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	29990873		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	10632337, 10995007, 27880058, 28681618, 29680307		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	10673743, 17823119, 23023919, 9746761		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11221855, 17244951, 18665036, 27756602, 28638459, 31286978		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	15638357, 17689858		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	17609769		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	10568827		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	17762183, 20885442, 21851414, 22296367, 22326293, 25359683, 28765921, 29257330, 29495302, 30239197		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	15041704		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	11075989, 28948694, 31760157		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	11567048, 24245549		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	30656694, 31485933		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	28030838		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	35848940	Associate	★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	23295054		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10995007, 28681618, 29680307		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	20809119		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	29344238, 31319483, 31669383		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	24090995, 26497583		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	28030838		★☆☆☆☆ Found in Text Mining only
AICARDI-GOUTIERES SYNDROME	Aicardi Goutieres Syndrome	BEFREE	18199533		★☆☆☆☆ Found in Text Mining only
Alexander Disease	Alexander Disease	BEFREE	21756903		★☆☆☆☆ Found in Text Mining only
Alexander Disease	Alexander disease	Pubtator	21756903, 31611638	Associate	★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	29949176		★☆☆☆☆ Found in Text Mining only
Alopecia, Male Pattern	Alopecia, Male Pattern	BEFREE	11399535		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	10550301, 12408229, 28985224, 29027727, 30611996, 32437347, 37553376, 38049398, 40363838	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	10582585, 18818379, 22307387, 40599432	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	18077176		★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	30986366		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	18077176		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	18077176		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	18077176		★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	29916145		★☆☆☆☆ Found in Text Mining only
Amyloid Neuropathies Familial	Amyloid neuropathy	Pubtator	11567048	Stimulate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	Pubtator	12408229	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	21396424, 26086249, 27227450, 28042540, 29039468, 29065557, 29297151, 30319347, 31237881, 31482248		★☆☆☆☆ Found in Text Mining only
AMYLOIDOSIS, HEREDITARY, TRANSTHYRETIN-RELATED	Amyloidosis	BEFREE	11567048		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	10764647, 12843244, 17823119, 21624464, 22764223, 24163136, 28336525, 28342750		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	LHGDN	16567804		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	22764223	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	26159164	Stimulate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	BEFREE	10726972, 15208263		★☆☆☆☆ Found in Text Mining only
Anaplastic Oligodendroglioma	Anaplastic Oligodendroglioma	BEFREE	21171016		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	26934320, 27145278		★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	16973504		★☆☆☆☆ Found in Text Mining only
Androgenetic Alopecia	Androgenetic Alopecia	BEFREE	11399535		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	15257717		★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	15257717	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	17711515	Inhibit	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	17711515		★☆☆☆☆ Found in Text Mining only
Anencephaly	Anencephaly	BEFREE	28786179		★☆☆☆☆ Found in Text Mining only
Anterior Cruciate Ligament Injuries	Anterior cruciate ligament injury	Pubtator	26762166	Associate	★☆☆☆☆ Found in Text Mining only
Anthracosis	Anthracosis	BEFREE	29416696		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	33849116	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	22978789	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	22978789	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Disease	Aortic valve disease	Pubtator	23968872	Associate	★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	28030838		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	25962658, 27919735, 29232010, 29968072, 30413028		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	36982526	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10817565, 19171073, 21923740, 23308194, 24452947, 24920239, 30352835, 32584515, 32692720, 33087158, 34766472	Associate	★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	BEFREE	25109708		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	15112054, 32446712	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	16711514, 16957584		★☆☆☆☆ Found in Text Mining only
Asymmetric crying face association	Asymmetric crying face association	BEFREE	28934226		★☆☆☆☆ Found in Text Mining only
Asymmetric Diabetic Proximal Motor Neuropathy	Asymmetric Diabetic Proximal Motor Neuropathy	CTD_human_DG	12502508		★☆☆☆☆ Found in Text Mining only
Ataxia	Ataxia	Pubtator	18160752, 18182848	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	10902739		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	11382748	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia, Spinocerebellar	Spinocerebellar Ataxia	BEFREE	11066010, 11719247, 15148151, 15483640, 21880333, 29325609, 9756151		★☆☆☆☆ Found in Text Mining only
Ataxias, Hereditary	Ataxia	BEFREE	7810581		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	18763039		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	24252910	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	25962658, 27919735, 29232010, 29968072, 30413028		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	10551709	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	25662045		★☆☆☆☆ Found in Text Mining only
Atrioventricular Septal Defect	Atrioventricular septal defect	BEFREE	30152577		★☆☆☆☆ Found in Text Mining only
Atrophy of testis	Testicular atrophy	BEFREE	28992606		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	31756355		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	36401485	Associate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	27019035		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	22651917, 30464201		★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	29434699		★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	26386150		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	BEFREE	18177647		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	18177647	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	15764395, 21567388, 21912938, 22771706, 23451095, 23985699, 24079479, 24112792, 24676391, 24718383, 24817408, 25025927, 25142231, 25230790, 25310109, 25405740, 25433945, 25816175, 25937271, 25993541, 26573436, 26592553, 26717963, 26755751, 26758192, 26823731, 26936314, 26986949, 27153225, 27568302, 27706722, 27803291, 27861461, 27864821, 27995262, 28024916, 28123569, 28138714, 28163176, 28252129, 28255363, 28260077, 28337226, 28340172, 28343296, 28352353, 28356967, 28359892, 28391633, 28405188, 28413517, 28413886, 28427190, 28447716, 28447737, 28454103, 28454434, 28454440, 28467977, 28487945, 28498386, 28534932, 28543910, 28544385, 28551635, 28554201, 28565827, 28565857, 28587346, 28588729, 28589243, 28627658, 28656215, 28656218, 28656225, 28673004, 28673008, 28677789, 28677799, 28693146, 28693160, 28693266, 28700107, 28731139, 28738542, 28748446, 28765913, 28765925, 28767701, 28789432, 28790819, 28808482, 28837114, 28849040, 28849044, 28849082, 28899515, 28912867, 28916896, 28927142, 28928845, 28943529, 28944839, 28944875, 28944912, 28962183, 28962186, 28963051, 28983616, 28983625, 28990045, 28990046, 29029410, 29039526, 29039549, 29039573, 29042987, 29050265, 29061824, 29062236, 29064407, 29085465, 29085508, 29098037, 29102932, 29104666, 29113186, 29115386, 29115483, 29115535, 29115607, 29127491, 29132010, 29138795, 29138847, 29201214, 29201227, 29201232, 29207012, 29207064, 29243778, 29247598, 29257247, 29257340, 29271988, 29285137, 29285175, 29286113, 29328385, 29328448, 29328470, 29344122, 29346503, 29363726, 29365089, 29374711, 29375685, 29375693, 29387218, 29393352, 29393425, 29393473, 29399101, 29399197, 29403552, 29432674, 29434733, 29436651, 29441873, 29454324, 29456668, 29456707, 29457525, 29464048, 29467861, 29467862, 29467874, 29484409, 29484431, 29524333, 29535596, 29545863, 29552161, 29552215, 29552219, 29552229, 29556279, 29562785, 29565494, 29572119, 29576796, 29599842, 29600563, 29607921, 29616116, 29616118, 29620243, 29620285, 29687848, 29693156, 29693708, 29710456, 29717768, 29731854, 29749542, 29750299, 29756671, 29762467, 29767237, 29767257, 29774101, 29792955, 29802156, 29805582, 29805606, 29805607, 29843139, 29867551, 29896252, 29896263, 29896271, 29901098, 29901138, 29923216, 29928326, 29928387, 29928421, 29939407, 29943471, 29949176, 29956776, 29956784, 29963166, 29963191, 29964132, 29990832, 30008912, 30013646, 30013659, 30015974, 30031796, 30040486, 30055129, 30058707, 30061179, 30061946, 30066940, 30070339, 30106086, 30106096, 30106156, 30116320, 30116377, 30127884, 30127912, 30127928, 30132572, 30146791, 30175514, 30186407, 30196309, 30197679, 30201862, 30202421, 30211660, 30214513, 30221731, 30231545, 30232032, 30233696, 30233716, 30270255, 30272262, 30283340, 30321469, 30323629, 30333888, 30339249, 30344751, 30344756, 30381663, 30384491, 30391688, 30429414, 30431064, 30431086, 30439707, 30446882, 30463061, 30467847, 30472432, 30477146, 30483812, 30503550, 30524947, 30535438, 30535477, 30536340, 30538798, 30563041, 30569095, 30569096, 30569175, 30575919, 30583528, 30599248, 30628687, 30628689, 30651766, 30655812, 30655881, 30657576, 30657580, 30659793, 30664150, 30675258, 30679990, 30699432, 30711951, 30719104, 30733641, 30735101, 30747219, 30747227, 30780111, 30798134, 30813721, 30816437, 30831390, 30844427, 30854075, 30864677, 30867372, 30867720, 30874982, 30884890, 30890112, 30891680, 30896788, 30909475, 30927660, 30930218, 30939721, 30957188, 30988759, 30988770, 30993644, 31004595, 31032945, 31039387, 31042421, 31054488, 31065990, 31071336, 31077207, 31115027, 31115494, 31115574, 31155547, 31161729, 31173173, 31173228, 31186742, 31210286, 31220671, 31234277, 31258692, 31262895, 31281315, 31322201, 31339741, 31340205, 31351435, 31363375, 31364141, 31364493, 31383785, 31387192, 31387329, 31389609, 31400930, 31410148, 31411791, 31412018, 31423257, 31433581, 31441362, 31442237, 31442950, 31465766, 31504911, 31524253, 31539107, 31553997, 31555365, 31566218, 31572063, 31586690, 31602247, 31603389, 31640181, 31642818, 31652453, 31652456, 31667861, 31717443, 31717470, 31717536, 31722249, 31729992, 31772601, 31772707, 31778769, 31782491, 31783811, 31789417, 31803052, 31847452, 31849486		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	26546525		★☆☆☆☆ Found in Text Mining only
Barth Syndrome	Barth syndrome	Pubtator	22023389	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	15986355	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	31211503		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	11351347, 15507514, 28327526, 28943529, 31263839		★☆☆☆☆ Found in Text Mining only
Bilateral Cryptorchidism	Cryptorchidism	CTD_human_DG	26050606		★☆☆☆☆ Found in Text Mining only
Binge Drinking	Binge drinking	Pubtator	12603597	Stimulate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	19945534	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	28463235	Stimulate	★☆☆☆☆ Found in Text Mining only
Bladder neck obstruction	Bladder neck obstruction	BEFREE	30140361		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	15304301, 16216409, 20025478, 21700414, 23064738, 23483488, 23811531, 27140445, 27275821, 28042037, 29207978		★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	27868136	Associate	★☆☆☆☆ Found in Text Mining only
Bloch Sulzberger syndrome	Incontinentia pigmenti syndrome	BEFREE	28017962		★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom syndrome	Pubtator	11470874	Associate	★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom Syndrome	BEFREE	30746281		★☆☆☆☆ Found in Text Mining only
Bohring syndrome	Bohring syndrome	Pubtator	22048168	Associate	★☆☆☆☆ Found in Text Mining only
BRACHYDACTYLY, TYPE B1	Brachydactyly	BEFREE	30042676		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	35848940	Associate	★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	31499069		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	11756504, 17901229		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Cerebral Ischemia	LHGDN	12605885		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Cerebral Ischemia	BEFREE	29956089, 30808918, 31707369		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain Neoplasms	BEFREE	12111801, 18338171, 24302539, 29552282, 30859090		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	18720359, 23271051	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	33501557	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11196185, 11420687, 12032672, 12181741, 12483536, 12576443, 12929741, 15770521, 15817572, 16131482, 16132579, 16171564, 17020986, 17490757, 18590557, 18758960, 18817771, 18820371, 20150224, 20348950, 21725820, 22751110, 23376331, 24952432, 25220225, 25894378, 26011589, 26298722, 26436206, 26516138, 27513956, 27666310, 27798717, 28378131, 28450532, 28601699, 29103019, 29228761, 29415413, 29492222, 29874411, 30205135, 30414102, 30446907, 30509086, 30539699, 30655766, 30655810, 30657046, 30662357, 30970626, 31037133, 31570209, 31649548, 9864397		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10371215, 11571297, 12644829, 14725611, 15163235, 15767684, 15830342, 16309219, 17490757, 18690087, 18820371, 19047049, 19223905, 19242112, 19245689, 19342873, 20150224, 20348950, 20955597, 21068479, 21127496, 21282976, 21901386, 22126498, 22216167, 23370279, 24347041, 24553912, 24896091, 24947113, 24952432, 25169499, 25190016, 25220225, 25268975, 25419573, 26011589, 26225696, 26383236, 27221871, 27798717, 27995416, 28987049, 30259091, 30290054, 30485942, 30873742, 31578772, 32186756, 32658903, 32705365, 32746451, 32766303, 33369440, 33369470, 33519190, 34369076, 34452574, 35291987, 36615253, 36765397, 36882618, 37116152, 37682166, 39844241, 40252335, 40390653	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17567922, 34360714	Stimulate	★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	29325609, 9813160		★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	27868136		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	11313717, 11482875, 22366408		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	18754867, 22131152, 22241218, 33325535, 37569852	Associate	★☆☆☆☆ Found in Text Mining only
C9 Deficiency	C9 deficiency	Pubtator	33362237	Associate	★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	23475579	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	18829519, 22901190, 25737553, 27556207, 27723786, 27798717, 28691902, 28700659	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	19765735	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10769711, 12576443, 15127291, 17020986, 20025478, 21317880, 23343959, 24918927, 29189263, 29565181		★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	18601533, 27061543	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	24927175	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	10884382, 12970919, 15098015, 15160348, 15378770, 16627981, 17695528, 18700866, 19140237, 19671867, 20345480, 23830978, 24287949, 24969544, 25260879, 25261655, 25403108, 25543761, 25755779, 26670903, 26718026, 26758428, 27255186, 27468214, 28350813, 28453560, 28534955, 28638890, 28677801, 29476051, 29523220, 29694502, 29749446, 29768061, 30443188, 31300048, 33294448, 33576897, 33642822, 33776365, 33883691, 33902004, 35127170, 35242200, 35572840, 36037300, 36351994, 38019231, 39256453, 40302327	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of ampulla of Vater	Ampullary Carcinoma	BEFREE	23343959		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	15304301, 16216409, 20025478, 21700414, 23064738, 23483488, 23811531, 27140445, 28042037, 29207978, 29769742		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	22388454, 24515920, 25586265, 28677816		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11802207, 12725325, 15152940, 18058802, 18665036, 20661084, 22242595, 23252748, 23857284, 24128051, 24384279, 25051115, 25352298, 25816208, 25917567, 26307684, 27723786, 28185768, 28440400, 28454469, 28693266, 29341059, 29746926, 29970649, 30259091, 30378152, 30402472, 30614802		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	30178832, 31210304	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	33850476	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33302576, 33759378, 34781823, 35414767	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22307387, 25330158, 27556207, 28114230, 33896245	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	23936061		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10656456, 11319608, 15156398, 16445627, 19962178, 22117079, 24858697, 25528169, 28972400, 29062236, 29245964, 29625193, 30197345, 30394813, 31239712, 31770410		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	12181128	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	12907417	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	31712853		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	12181128, 25888309	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	28106847, 28695302, 29147465, 30070262, 31353329		★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	11779095	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	26956740	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	27061232		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	23991739, 37455655	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Cavernous Malformations 3	Cerebral Cavernous Malformation	BEFREE	19246713		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	12605885, 25001514, 29956089, 30174518, 30481625, 30822224, 31073782, 31516045, 31611791		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	27776139	Inhibit	★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	30127816, 31264214		★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral Microangiopathy	BEFREE	29257241		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	15573409, 21087606, 23939807, 24970391, 27773791, 28274860, 28506087, 28885866, 29278729, 29501622, 29896428, 30755766, 30822224, 31849446		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	15740652, 20213048, 26733262, 27261616, 27363024, 27505047, 28114230, 28537893, 28963664, 29720427, 30194152		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	30691208		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	15740652, 20213048, 24469707, 26733262, 27261616, 27363024, 27505047, 28114230, 28537893, 28963664, 29720427, 30194152, 31284780		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	10995007, 20232432, 28681618, 29680307		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	29344238, 31319483, 31669383		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	16927143, 23121546, 29189263, 30652346		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	28662515, 32246704, 34181351, 35683032	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	39344395	Stimulate	★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	BEFREE	16371840		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	20127255, 25501832, 28600541, 30586948		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	27983929, 30400387		★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	BEFREE	30467700		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	21262580	Stimulate	★☆☆☆☆ Found in Text Mining only
Chronic eosinophilic leukemia	Eosinophilic Leukemia	BEFREE	24472312		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	20431038		★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	31530262		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	17071630, 23201402, 26546525, 26603518, 26897372, 27488117, 27719921, 28034907, 28301251, 28442922, 28969553, 28978315, 29496469, 30135489, 30608887, 31637186, 31681329, 9808574		★☆☆☆☆ Found in Text Mining only
Chronic mountain sickness	Mountain sickness	BEFREE	29357502		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	19942343		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	19168702, 21197447, 28006950, 29164557, 31333459		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	26782454, 29021368		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	24980229, 25238746		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	24980229		★☆☆☆☆ Found in Text Mining only
Chronobiology Disorders	Chronobiology disorder	Pubtator	19940360	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	29321963		★☆☆☆☆ Found in Text Mining only
Classical galactosemia	Galactosemia	BEFREE	31422495		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	26795696	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	30372842		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	36455873	Associate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	33447019	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	20693187, 25533544, 25926267, 26047848		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	29922282, 35085569	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	31159239, 37078344	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10915781, 16505115, 17172814, 18388920, 22110202, 24885920, 25738796, 25906152, 27509880, 28887536, 29465116, 29524226, 29564000, 29611024, 30630646, 30806395		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	17436592, 17805550, 18256791		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	24317430, 30088538, 31040202	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17183061, 18027258, 20673328, 21723078, 24839934, 24992592, 25269802, 25303828, 26047848, 26844701, 27221111, 27461654, 27559856, 29355114, 29489504, 30061944, 30191976, 30344756, 30410539, 30588113, 31430901, 31671847		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10915781, 11351040, 12033956, 16433033, 17201158, 17395183, 17436592, 19137010, 20930850, 21403907, 22481083, 22536331, 23591201, 23893182, 24992592, 25197379, 25684945, 25906152, 25986235, 26844701, 27055667, 27235711, 27461654, 28143990, 28972559, 29393430, 29524226, 29801534, 30361551, 30477538, 31199053, 31633448, 32000660, 32277680, 32495637, 33878735, 34512817, 35468741, 37516866, 37530327, 37658940, 37933160	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	30464201		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	30464201	Associate	★☆☆☆☆ Found in Text Mining only
Complex Partial Status Epilepticus	Status Epilepticus	CTD_human_DG	16679645, 18571097		★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	11086807		★☆☆☆☆ Found in Text Mining only
Congenital cerebral hernia	Congenital Cerebral Hernia	BEFREE	28786179		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	10632337		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	19223178, 28895407, 28913568, 30582202, 31409772		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	12874181, 20202977, 25799225, 26188824, 26228789, 28753907, 28849082, 28900504, 29111293, 29124661, 30404073, 30575044, 31119267		★☆☆☆☆ Found in Text Mining only
Conn Adenoma	Conn Adenoma	BEFREE	7575587		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	12796377, 17541305, 19380190, 23759948, 27710896, 27779645, 28544385, 29251173, 30179778, 30522045		★☆☆☆☆ Found in Text Mining only
Copper-Overload Cirrhosis	Copper-Overload Cirrhosis	CTD_human_DG	22879914		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	29398472, 30783483		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	21889313, 23894522, 26263983, 33593717, 34309093	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	28633917		★☆☆☆☆ Found in Text Mining only
Corticobasal degeneration	Corticobasal Degeneration	BEFREE	11205141		★☆☆☆☆ Found in Text Mining only
Craniosynostoses	Craniosynostosis	Pubtator	29847820	Stimulate	★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	28337255		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	20693187, 24553140, 28286054		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	31159239	Stimulate	★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	CTD_human_DG	26050606		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cutaneous Melanoma	Melanoma	BEFREE	31535400		★☆☆☆☆ Found in Text Mining only
Cyclic neutropenia	Cyclic Neutropenia	BEFREE	30880689		★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	16445638		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	16337881, 19168702, 29486923		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	10821855, 23217276, 23603903, 26586481, 26718307, 28223125, 28585864, 28744712, 28968949, 29138829, 29891807, 29922443, 30261492		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	24341417, 28290606		★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	24455679, 29247598, 29885845, 30134805, 30229836, 30280789, 31593895		★☆☆☆☆ Found in Text Mining only
Dentatorubral-Pallidoluysian Atrophy	Dentatorubral Pallidoluysian Atrophy	BEFREE	11066010, 11445634		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	16689860		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	23119081, 24934088, 27748317, 28105508, 28265179, 28944839, 29078040, 29211763, 29231060, 29399092, 29476359, 29700294, 29754274, 30937278		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	19175688, 23335850, 26782377, 29302057, 34140543, 34309093	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	21549702, 31587010	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	23119081, 24934088, 26648531, 27748317, 28105508, 28265179, 28861343, 28944839, 29078040, 29211763, 29231060, 29399092, 29476359, 29700294, 29754274, 30210683, 30237226, 30284252, 30378157, 30477146, 30607864, 30651825, 30937278, 31468454		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	29072691	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	34697343	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	30024959, 34309093, 36736734	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	30593206	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	15762195, 21706480, 22079479, 28185128, 29145717, 29850590, 31030170, 31290273, 31398260		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	15531508		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	25611567, 27317602, 27638126, 29115422, 30024959, 30453650, 30593206, 31578271, 31691259		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Amyotrophy	Diabetic Amyotrophy	CTD_human_DG	12502508		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	CTD_human_DG	25381014		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Asymmetric Polyneuropathy	Diabetic Asymmetric Polyneuropathy	CTD_human_DG	12502508		★☆☆☆☆ Found in Text Mining only
Diabetic Autonomic Neuropathy	Diabetic Autonomic Neuropathy	CTD_human_DG	12502508		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	34293021	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Mononeuropathy	Diabetic Mononeuropathy	CTD_human_DG	12502508		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	35843953, 35932042, 37986381	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	31281543, 31685975, 31755322		★☆☆☆☆ Found in Text Mining only
Diabetic Neuralgia	Diabetic Neuralgia	CTD_human_DG	12502508		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	CTD_human_DG	12502508		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	28682956		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Polyneuropathies	Diabetic polyneuropathy	CTD_human_DG	12502508		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	CTD_human_DG	20654064		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	31799636		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	31799636	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	11222085, 20809119, 29104626		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	LHGDN	15657349		★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	29687861		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	10550301	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	LHGDN	12070657		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	14678752, 23554291, 24338704, 31176774		★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	16977583		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	12576443, 16563451		★☆☆☆☆ Found in Text Mining only
Dysequilibrium syndrome	Dysequilibrium syndrome	Pubtator	32572905, 37052975	Associate	★☆☆☆☆ Found in Text Mining only
Dyskinesias	Dyskinesia	Pubtator	27556207	Associate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	37531036	Stimulate	★☆☆☆☆ Found in Text Mining only
Dystonia Disorders	Dystonia	BEFREE	29089256		★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	24746199		★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	31293101	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Encephalitis	Encephalitis	BEFREE	10564527, 24198425		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	26092112	Associate	★☆☆☆☆ Found in Text Mining only
Encephalocele	Encephalocele	BEFREE	28786179		★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	10564527		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	11603220, 19531679, 29626374		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	21171931	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	30657459		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	19531679, 21888833, 28421904, 30628640, 31127027, 32407273, 35442481, 35725817	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	30071521		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	34746304	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	28492982, 30077908, 31173166		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	32219137, 37833937	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	LHGDN	16121124		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	31392787		★☆☆☆☆ Found in Text Mining only
Episodic ataxia type 2 (disorder)	Episodic Ataxia	BEFREE	11992880		★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	28341240		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	19962178, 31239712		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	30477146		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	23820115, 25816175, 28099140		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	16425431, 22136337, 23820115	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	23820115, 25816175, 28099140		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	22136337, 24764681, 27723786, 28277193, 32071920, 33650646	Associate	★☆☆☆☆ Found in Text Mining only
Esophagitis	Esotropia	Pubtator	22901192	Associate	★☆☆☆☆ Found in Text Mining only
Esophagitis	Esophagitis	BEFREE	24357184		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	30519038		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	11278424, 16908971, 18184791		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	18077176		★☆☆☆☆ Found in Text Mining only
Familial benign pemphigus	Benign Pemphigus	BEFREE	25658765		★☆☆☆☆ Found in Text Mining only
Familial cylindromatosis	Familial cylindromatosis	Pubtator	32901872	Stimulate	★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	29605770		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	28493083		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	11110692, 12200363		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	20068062, 34954697	Associate	★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	11110692, 12200363		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	18290776		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	25400762, 36083487	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	20888662, 21814826, 28264426, 28595079, 29079763		★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	12576443		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	12364438, 30503138		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	28428881, 28789428		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	26555271, 27748901, 30669350, 31213776		★☆☆☆☆ Found in Text Mining only
Focal Cortical Dysplasia	Focal cortical dysplasia	Pubtator	37833937	Associate	★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia of Taylor	Focal cortical dysplasia	Pubtator	23586324	Stimulate	★☆☆☆☆ Found in Text Mining only
Friedreich Ataxia	Friedreich Ataxia	BEFREE	9756151		★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	22113996, 25929520, 30635474, 9949201		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	26335643, 26567742		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	32727073	Associate	★☆☆☆☆ Found in Text Mining only
Fulminant hepatitis	Fulminant Hepatitis	BEFREE	31712142		★☆☆☆☆ Found in Text Mining only
Galactosemias	Galactosemia	BEFREE	31422495		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	24009453, 29513793	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	31320912		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	32883271	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	LHGDN	19043361		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11772428, 12111801, 12558990, 15208263, 15333583, 18669646, 20072652, 20716639, 21743969, 22964638, 24805821, 25038272, 26082034, 29113289, 29236891, 29329030, 29575236, 29936383, 29940755, 29949238, 30092165, 30179612, 30503550, 30852975, 31073903, 31575848		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	11772428, 11883844, 18669646, 20730317, 21508666, 24213561, 24561085, 24805821, 28656196, 29236891, 29780826, 30852975, 31073903, 31390836, 32210117, 32446712, 32504326, 32565597, 34784707, 35658846, 35918659, 35977996, 36838582, 40133216	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	18171980, 18814044		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	11772428, 12111801, 12558990, 15208263, 15333583, 18669646, 18759060, 20072652, 20716639, 21743969, 22964638, 24278406, 24805821, 25038272, 25202074, 26082034, 29113289, 29236891, 29329030, 29575236, 29936383, 29940755, 29949238, 30092165, 30179612, 30503550, 30852975, 31073903, 31332862, 31575848		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10930016, 11522296, 15690127, 15922963, 18669646, 20676365, 21150246, 26223576, 26559910, 27448842, 27618552, 28409498, 28663034, 28858735, 29113289, 29329030, 29486949, 30260020, 30680690, 30686753, 30859090, 30924320, 30972632, 31810928		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	15015772, 17606719		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	15523899, 17804742, 18669646, 19001440, 23035900, 23280445, 25355637, 25532840, 25755779, 26223576, 26748401, 27893811, 29164574, 29866060, 30537994, 30927504, 33920356, 35848940, 35981653, 36570001, 36795994, 37918583	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	29316313	Inhibit	★☆☆☆☆ Found in Text Mining only
Globoid cell leukodystrophy	Globoid Cell Leukodystrophy	BEFREE	24094551		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	21974877	Stimulate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	33147279	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type II	Glycogen storage disease	Pubtator	24581426	Associate	★☆☆☆☆ Found in Text Mining only
Grand Mal Status Epilepticus	Grand Mal Status Epilepticus	CTD_human_DG	16679645, 18571097		★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	36561758	Stimulate	★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	27803291		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	29434699		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	36807042	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	22895509, 23271051, 31768101		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	22307387	Stimulate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	23271051, 37371038	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	20022263	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	12874181, 20202977, 25799225, 26188824, 26228789, 28753907, 28900504, 29111293, 29124661, 30404073, 30575044, 31119267		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	18279768	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	29847820	Associate	★☆☆☆☆ Found in Text Mining only
Heart valve disease	Cardiac valvular disease	CTD_human_DG	21335463		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemangioma	Hemangioma	BEFREE	28339093		★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	22568453	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	27742710	Associate	★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	14633779		★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	9840908	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	32293395	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	32050950	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	22095390		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	10574243	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary hemorrhagic telangiectasia	Hereditary Hemorrhagic Telangiectasia	BEFREE	26991610		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	10329597, 11376869, 12070005, 9310497	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	11376869, 15127291		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	12070005		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	10502825, 11719247, 11765125, 16289252, 21068307		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	36902304	Associate	★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	30467700		★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	BEFREE	30790647		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	22273152		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	23985558	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	24936444, 28912721, 29211763, 31185507		★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	28507207, 31439521		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	17558734	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29399101, 30906464		★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	30566000		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	31078153		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	12181128, 17273772, 17600131, 19794957, 23485709, 26464645, 28402449, 32296107, 32351020, 35409364, 39519249	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	18326038, 22087251, 25684163, 25849550, 29357502, 29790920, 30355438, 31992313, 33174051	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19919574, 29466367	Inhibit	★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	21872252		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	11334117, 18635891, 23580232	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	19597127, 23580232		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	34209019	Stimulate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	30880546		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	30936868		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	25387335, 28193522, 28386342, 29042986, 29289695, 30372842, 30746238, 31030091, 31057171		★☆☆☆☆ Found in Text Mining only
Infantile neuronal ceroid lipofuscinosis	Neuronal Ceroid Lipofuscinosis	BEFREE	16644870		★☆☆☆☆ Found in Text Mining only
Infarction, Middle Cerebral Artery	Cerebral Infraction	BEFREE	31115825		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	23218678	Inhibit	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	20693187, 30448733, 31672153		★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	18828606, 26142340		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	15738783, 24389166, 30056756, 30439528		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	18302283, 34805401	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	33090383	Stimulate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	21706480, 31290273		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	17557866	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	28056337		★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	16714395	Stimulate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	23374352		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	17430778		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	LHGDN	17430778		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	29085497		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	29906559, 29990833		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	36611912	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	30230140		★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	24705272		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28069373, 28274860, 28365474, 29312600, 30354994, 31334597		★☆☆☆☆ Found in Text Mining only
Jaundice, Obstructive	Jaundice	BEFREE	31671112		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	16540654, 17951202, 19539619, 22174674, 24027049		★☆☆☆☆ Found in Text Mining only
Kashin-Beck Disease	Kashin-Beck Disease	BEFREE	30680829, 31762289		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	28926773		★☆☆☆☆ Found in Text Mining only
Keratocystic Odontogenic Tumor	Keratocystic Odontogenic Tumor	BEFREE	28238093		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	LHGDN	12036886, 14657946		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	31440817		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	33138038	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28569136, 29038261, 29446739, 29883558, 30047127, 30526689, 30700847, 31682847, 31732832, 31801607, 31813254		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	30643536		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	29131025, 31424686	Associate	★☆☆☆☆ Found in Text Mining only
Laron Syndrome	Laron Syndrome	BEFREE	29208357		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	28455995	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	28475003, 30733838		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	28483502, 29523174, 30503138	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	22556343	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10989191, 11238127, 15171819, 15843042, 16595897, 16769721, 17561974, 17603173, 17993614, 19809251, 20105315, 20704577, 21190589, 21881314, 22412883, 22496955, 24016597, 24099795, 30088262, 33924032, 36585521, 37630388	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	11840289, 12032672, 17531122, 18487508, 18941120, 21617838, 23173725, 28395566, 28440458, 28700107, 29350920, 29523407, 29732888, 29990873, 30731134		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	17219053		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	20640151	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	11090079, 12576328, 18160664, 19463775, 19652057, 20557671, 21595920, 21695163, 21998731, 22308476, 23320127, 31114982, 31831875, 32783661, 34895042, 35873796, 38085150	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	12926551, 17201156, 24356076, 30551620, 30825052, 9489995, 9746761, 9920855	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10632337, 12642862, 18160664, 19383925, 28032588, 28381396, 28727820, 29864778		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	24090995		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	22023389, 22115939, 28911066		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	10961423		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	34686734	Associate	★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	28166996		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	12820420, 22595944, 23238519, 26595239, 28927146		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	24583153		★☆☆☆☆ Found in Text Mining only
Liposarcoma Myxoid	Liposarcoma	Pubtator	20863376	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10928128, 12632104, 15044962, 15521050, 17303011, 18027258, 18298346, 18497990, 18949401, 19671867, 21190094, 21214951, 21810437, 23499292, 24918927, 24985939, 25214410, 25592041, 25997995, 26004524, 26089158, 26555544, 26615145, 26758428, 26884832, 27334973, 27718258, 27748917, 28096271, 28428881, 28469766, 28486557, 28653316, 28677801, 28821164, 28983625, 29253760, 29523220, 29561429, 29578179, 29752472, 30205014, 30280770, 30439528, 30445021, 30536880, 30590774, 30636171, 30660690, 30725182, 30925457, 31084510, 31129132, 31300048, 31368655, 31409969, 31563690, 31656043, 31708277		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	15098015, 15220451, 17983802		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	29321963		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	12393901	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	20644519, 30446523		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	15044962, 18027258, 18949401, 25077527, 26089158, 31409969		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	28270653, 29901131	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	17586700, 18468406	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	10733772, 15152940, 18008356, 18612434, 20661084, 24441772, 26307684, 26647102, 27723786, 29565268, 29970649, 30332761, 30443171, 34553845, 35898682, 37984526, 38554387	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	11960384, 11992386, 16242324, 18058802		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	22606268, 23361589, 28298068, 28330997, 29733528		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Cutaneous	Cutaneous lupus erythematosus	Pubtator	33931094	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	16116236, 18507053, 22940256	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	19644848, 27183584	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	16116236, 29602774		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	16808908		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	LHGDN	16931214		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	29446059		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	19140237, 22302483, 25197379, 33501557	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	11866986, 12897143		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	12897143, 15576477, 19223368, 22496955, 30088262, 30266952	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	15961076, 19363496, 27719921, 28440458, 28627620, 30266952		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	12756297, 24660851, 37824846	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	12756297, 17071630, 21855110, 24660851		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	17071630, 26062471, 9787177		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	17071630		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	26062471		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	31787505		★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	24312611, 28599439		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	22895509, 23271051, 31768101		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	30859090		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11196185, 11420687, 12181741, 12483536, 12576443, 12929741, 15770521, 16131482, 16132579, 16171564, 17490757, 18590557, 18758960, 18817771, 18820371, 20348950, 21725820, 22751110, 23376331, 24952432, 25220225, 25894378, 26011589, 26298722, 26436206, 26516138, 27513956, 27666310, 27798717, 28378131, 28450532, 29103019, 29228761, 29415413, 29492222, 29874411, 30205135, 30414102, 30446907, 30509086, 30539699, 30655766, 30655810, 30657046, 30662357, 31037133, 31570209, 31649548		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	19531679, 29626374		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	23820115, 25816175, 28099140		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	17262081		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	16951166		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	24515920, 25586265		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	17589894, 23784371, 25543761, 27942213, 28966688, 29393410, 29498407		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11802207, 12725325, 15127291, 18058802, 20661084, 22242595, 23252748, 23857284, 24128051, 24384279, 25051115, 25816208, 25917567, 26307684, 27723786, 28185768, 28440400, 28454469, 28693266, 29341059, 29746926, 29970649, 30259091, 30378152, 30402472, 30614802		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	23238519, 26595239, 28927146		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of oropharynx	Malignant Neoplasm Of Oropharynx	BEFREE	31587185		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	10656456, 11319608, 15156398, 16445627, 22117079, 24858697, 25528169, 28972400, 29062236, 29245964, 29625193, 30197345, 30394813, 31770410		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	17721921, 21479361, 25725585, 26228206, 28058630, 28339041, 28656219, 30359541, 30595801		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11196158, 11221855, 11351347, 16585199, 18852124, 21668377, 22564737, 22858003, 23170075, 23726840, 24652480, 25349289, 25566960, 26877821, 27462923, 28314844, 28731173, 29200739, 29392925, 30176316, 31389670		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	29693192		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	12643601, 12854132, 12918097, 15791436, 15860933, 20530714, 24220265, 24896321, 25002346, 26779638, 26869189, 27016414, 29183726, 29393470, 29501797, 30015872, 31599422, 31802897		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	19846952		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	15304301, 16216409, 20025478, 21700414, 23064738, 23483488, 23811531, 27140445, 28042037, 29207978, 29769742		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10022118, 10200502, 10772815, 11593405, 12643601, 12697268, 12854132, 12907145, 15521050, 16132579, 17096027, 17172814, 17695541, 18058802, 18388920, 18623086, 18922933, 19223905, 19342873, 19513564, 19531679, 19908232, 21266363, 22058146, 22371336, 22445251, 22692727, 22735990, 23271051, 23292806, 23765963, 23979166, 24508804, 24521149, 24949471, 25022618, 25189649, 25296535, 25303828, 25608836, 26253167, 26555544, 26758428, 26768747, 26917536, 27187358, 27297867, 27826040, 27991692, 28030838, 28096271, 28100275, 28112201, 28114230, 28284148, 28287256, 28343074, 28599449, 28661475, 28677816, 28732240, 28837260, 28848149, 28955297, 29137419, 29157470, 29223099, 29273564, 29311118, 29318034, 29331758, 29355114, 29407986, 29463109, 29524226, 29575045, 29748384, 29749535, 30002278, 30097112, 30324892, 30368918, 30394813, 30479220, 30526368, 30618284, 30647533, 30720785, 30826510, 30908935, 30979970, 31015910, 31030314, 31068932, 31082763, 31260254, 31262873, 31264668, 31563816, 31611309, 9864397		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	15740652, 20213048, 26733262, 27261616, 27363024, 27505047, 28114230, 28537893, 28963664, 29720427, 30194152		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10915781, 18388920, 22110202, 24885920, 25738796, 25906152, 27509880, 28887536, 29465116, 29524226, 29564000, 29611024, 30630646, 30806395		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	31992313	Stimulate	★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	12483536, 17020986, 18953692, 19047049, 28145547, 29986606, 31576539		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12483536, 12576443		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	17267661, 26658105, 27338091		★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	17071630		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	BEFREE	19383925		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	23329180		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	15999545, 19887560, 27537345, 35593307	Associate	★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	29344238, 31319483, 31669383		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10802053, 17024575, 17652623, 18202806, 19200201, 23173725, 23695439, 23744355, 26678033, 28208804, 30599074, 30783791, 31092422, 31535400, 31675048		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11369232, 32236901, 38166464	Stimulate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11511312, 21547369, 21924824, 23527236, 25016296, 28208804, 30866426, 30989459, 31292999, 31778440, 33046735, 33573155, 33833342, 36241419, 37156818	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15033720, 18256758		★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	37950289	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	LHGDN	17143787		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	17181554, 25247996, 26240495	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	23315006, 24188277, 25247996, 30859090		★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	29687461		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	15996160, 18511708, 23525508, 28090191, 28223140		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	LHGDN	15996160		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	24924397, 29748013	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	27864821, 30071531		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	24519926, 28744401		★☆☆☆☆ Found in Text Mining only
Microangiopathy, Diabetic	Diabetic cardiomyopathy	CTD_human_DG	25381014		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	18077176		★☆☆☆☆ Found in Text Mining only
Mitochondrial complex I deficiency	Mitochondrial complex deficiency	Pubtator	12437580	Stimulate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	11810183		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	22994717, 24920239, 25879420, 27223122, 28441753, 29424907, 38272357	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	24099795, 32286137, 32733636	Stimulate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	29516570	Inhibit	★☆☆☆☆ Found in Text Mining only
MOHR-TRANEBJAERG SYNDROME	MOHR-TRANEBJAERG SYNDROME	BEFREE	17477363		★☆☆☆☆ Found in Text Mining only
Motor Disorders	Motor Disorders	BEFREE	30121327		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor neuron disease	Pubtator	37010860	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	34762658	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	23212344, 24337492, 27556207, 27827950, 27941877, 34318593, 35268676, 35328402	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	26595239	Stimulate	★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya Disease	BEFREE	17038954, 30668528		★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya Disease	LHGDN	17038954		★☆☆☆☆ Found in Text Mining only
Moyamoya disease 1	Moyamoya disease	BEFREE	17038954, 30668528		★☆☆☆☆ Found in Text Mining only
Mucinous carcinoma of breast	Mucinous Carcinoma Of Breast	BEFREE	29085497		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	20423928, 21160486, 21987091, 23894522, 24162006, 29152908		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	20423928, 23894522, 24903211	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	37506144	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	19109096, 27981346, 30968512		★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis IV	Mucopolysaccharidosis	Pubtator	37762422	Associate	★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	17071630		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10720689, 12100143, 12531793, 15070698, 15626742, 17910628, 18381704, 20860474, 20953137, 22142798, 22471522, 26724804, 27902770, 28270494, 29486474, 29562955, 31564190, 31918281, 34584036, 37628771	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	12393500, 15961076, 16166312, 18381704, 24481531, 24504138, 25122609, 26724804, 27189701, 28264449, 28858294, 28962646, 29472861, 29944867		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	12393500, 18381704	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	28264449	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	12359060	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	19604093	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	29022246, 31047767		★☆☆☆☆ Found in Text Mining only
Muscular Atrophy Spinal	Spinal muscular atrophy	Pubtator	22723941	Stimulate	★☆☆☆☆ Found in Text Mining only
Muscular Atrophy Spinal	Spinal muscular atrophy	Pubtator	40018937	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	25791035		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	11282171		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	17354625	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	10497846, 12512919, 22115939		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	LHGDN	17245643		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	11882355	Inhibit	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	27665715	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	19073171		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	11123359, 24574458, 26629937, 31515251		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	19942343		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	31819634		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	12411458, 23453036, 28784995, 29184499, 29556355, 30486235, 30964183, 30994964, 31063767, 31375326, 31630586, 31708788		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	25450231		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	29197221, 35757636	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	29398472, 30783483		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	40620566	Associate	★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	Pubtator	17007104	Associate	★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	24401606		★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	30378157		★☆☆☆☆ Found in Text Mining only
Myxoma of heart	Myxoma Of Heart	BEFREE	15696123		★☆☆☆☆ Found in Text Mining only
Myxoma of the Endocardium	Myxoma Of The Endocardium	BEFREE	15696123		★☆☆☆☆ Found in Text Mining only
Nail-Patella Syndrome	Nail-Patella Syndrome	BEFREE	30233679		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	24980229		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	29306235	Inhibit	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	15330177, 15803189, 24961145, 25337187, 29256858, 30844723, 31566021, 31991751, 32448862	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	16899621, 17156515, 17172814, 17881119, 25118937, 27811359, 29649994, 30402158, 30524968, 30590314, 30844723, 30975469, 30985039, 31059711		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	36225172	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	10944606, 11414470, 18669646, 20637078, 20816779, 24623967, 25906152, 29079763, 31293101	Associate	★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	23936061, 28846670, 30005955, 30465999, 31786582		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10637446, 10706081, 10769711, 11075989, 11588050, 11929818, 12111801, 12455052, 12483536, 12576443, 12632104, 12766579, 12907145, 12918097, 14532847, 14583479, 14627349, 14647417, 15010879, 15101558, 15163544, 15517578, 15521050, 15770521, 15833852, 15930341, 16020484, 16033847, 16091489, 16158048, 16597645, 16711514, 16926120, 16977583, 17202676, 17235304, 17236181, 17363184, 17374729, 17407311, 17413988, 17431123, 17951202, 18027258, 18060030, 18063749, 18338171, 18497990, 18593907, 18623086, 18653704, 18708754, 19223178, 19223770, 19251093, 19289568, 19360334, 19380190, 19450997, 19509158, 19509237, 19676053, 19724860, 19737940, 19913908, 20025478, 20064086, 20187794, 20463309, 20628003, 20841474, 21266363, 21415167, 21423208, 21450822, 21471201, 21685937, 21704663, 21725820, 21785270, 21869593, 21878655, 22000275, 22018604, 22307387, 22393311, 22412883, 22445251, 22472110, 22619347, 22761710, 22911820, 22922684, 22926751, 23021083, 23201752, 23202800, 23533664, 23543150, 23570653, 23588242, 23595697, 23611960, 23725141, 23729403, 23922634, 23979166, 24040280, 24111856, 24115240, 24130112, 24440344, 24469707, 24481444, 24612139, 24694877, 24718383, 24824754, 24858697, 25060748, 25118937, 25174355, 25230790, 25340777, 25359683, 25395275, 25479732, 25528169, 25549720, 25571952, 25677845, 25820993, 25909216, 26044560, 26156229, 26215403, 26292265, 26406409, 26431328, 26820128, 26844701, 26915683, 27009166, 27187358, 27221871, 27335087, 27343059, 27371094, 27573304, 27941877, 28030838, 28039264, 28050749, 28079268, 28099140, 28109073, 28110575, 28123591, 28138030, 28138695, 28145547, 28150874, 28238093, 28245646, 28259153, 28270160, 28284148, 28344313, 28351890, 28363658, 28377488, 28388009, 28414103, 28440479, 28453560, 28479722, 28508578, 28537893, 28600541, 28618188, 28628830, 28656213, 28671975, 28700659, 28732240, 28755734, 28759039, 28781948, 28801587, 28880032, 28880262, 28895407, 28977925, 28980419, 29048641, 29113289, 29137419, 29154934, 29245964, 29355114, 29492222, 29494356, 29501797, 29513792, 29524226, 29549251, 29578179, 29666220, 29693134, 29695251, 29770446, 29794225, 29795329, 29844573, 29885348, 29895719, 29901224, 29906465, 29907593, 29925966, 29938225, 29972254, 29983002, 29984732, 30026860, 30044833, 30103745, 30150436, 30179778, 30259091, 30292644, 30378150, 30392087, 30410370, 30425572, 30446907, 30447398, 30448733, 30448904, 30450577, 30466620, 30478850, 30499763, 30503550, 30518159, 30600364, 30601064, 30617443, 30642742, 30651826, 30659905, 30664175, 30705400, 30738018, 30745832, 30778617, 30783791, 30797554, 30852975, 30992459, 31030593, 31033991, 31040647, 31040894, 31092422, 31128995, 31136759, 31143704, 31205067, 31239712, 31259422, 31262891, 31519811, 31521320, 31530543, 31548293, 31559608, 31576765, 31587185, 31590966, 31612002, 31695423, 31715238, 31824157, 9671409		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	25824335		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	28849172		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	22244202		★☆☆☆☆ Found in Text Mining only
Nephrosis Lipoid	Nephrotic syndrome	Pubtator	33147279	Associate	★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	CTD_human_DG	12196588		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
nervous system disorder	Nervous System Disorder	BEFREE	26335643, 30217453		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neural Tube Defects	Neural Tube Defect	BEFREE	28786179, 29693124		★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	30977509		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	10567913, 11953454, 12378022, 14617628, 15961390, 18379052, 19308291, 20044605, 21298033, 23710710, 26208481, 26883171, 38282862	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10721769, 11027660, 11032874, 11953454, 12523938, 14499695, 14617628, 15030396, 15208263, 15447660, 15460444, 15657348, 15774829, 15953364, 16424024, 18059134, 18338171, 18379052, 20487627, 20821386, 21298033, 21354306, 21892618, 21998304, 23774476, 24788776, 25736927, 26224681, 26745078, 28429453, 28569571, 28709447, 28790888, 29715465, 29804239, 29977157, 30034627, 30237861, 30717087		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	LHGDN	15473998		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	22818651, 28287256, 28637381, 28730337, 29327278, 31049133, 31221560		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	12659841		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	28363001		★☆☆☆☆ Found in Text Mining only
Neuroferritinopathy	Neuroferritinopathy	BEFREE	16825958		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	24346802	Associate	★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	21880333, 28645005, 30592963		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	22023389, 28911066		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	22023389	Associate	★☆☆☆☆ Found in Text Mining only
Nevus comedonicus	Nevus comedonicus	BEFREE	27485415		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28216552, 30430605		★☆☆☆☆ Found in Text Mining only
Non-Convulsive Status Epilepticus	Nonconvulsive status epilepticus	CTD_human_DG	16679645, 18571097		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	10769711, 11802207, 11992386, 15101558, 16827119, 18575718, 18612434, 21077998, 21733335, 22438908, 22568453, 23352573, 24367688, 24718383, 25342427, 26307684, 26768747, 28265596, 28351890, 28460475, 28638459, 28945763, 28982084, 29256070, 29311118, 30307120, 30651886, 30831390, 31817093		★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	17673919		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	22836687, 23193206, 27900559	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	25914268, 31321239		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	27481183, 37991453	Stimulate	★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	25109708, 30720109		★☆☆☆☆ Found in Text Mining only
Olivopontocerebellar Atrophies	Olivopontocerebellar Atrophies	BEFREE	9630233		★☆☆☆☆ Found in Text Mining only
Oncocytoma, renal	Oncocytoma of kidney	BEFREE	30467700		★☆☆☆☆ Found in Text Mining only
Optic Atrophy, Hereditary, Leber	Hereditary Leber Optic Atrophy	BEFREE	15033723		★☆☆☆☆ Found in Text Mining only
Optic Neuropathy	Optic Neuropathy	BEFREE	21850191		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	31587185		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	10088775, 11779095, 23603903, 28805067, 32767319, 33468167, 33677475, 34496641, 35069930	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	31762289	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	28203483, 30317635		★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	28790819	Associate	★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	31564830, 33355373, 36372373, 36496986	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	15599395		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	26934099		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	35069454, 35990678, 36626454, 38129425	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	29115612		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	12012007, 12154052, 15126291, 15965098, 20376536, 20580954, 21717192, 22610481, 23266503, 23830991, 24312611, 24639013, 24750000, 24797937, 24871663, 25326586, 25339006, 25522670, 26351207, 26573608, 27019355, 28387888, 28627658, 28635396, 28839383, 28849129, 29115549, 29363721, 29403292, 29434958, 29434992, 29565481, 29573114, 29733528, 29845282, 29895719, 30015899, 30065912, 30352834, 30582213, 30988774, 31263675, 31535374, 31814757		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	14710359		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	20459702, 22231496, 25339006, 25677904, 26351207, 26569226, 29750154, 30015899, 30403180, 31433581, 32075661, 32721630, 38297292	Associate	★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	BEFREE	21269505, 29780828		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	24858697, 25528169		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	37883761	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	29851197		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	10656456, 11319608, 15156398, 16445627, 16445638, 22117079, 28972400, 29062236, 29245964, 29625193, 30197345, 30394813, 31770410		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	11972398, 15156398, 16882668		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	16882668, 22110186, 22843880, 23345014, 23762410, 24842412, 24921663, 25143136, 25313764, 25509983, 26067645, 28440479, 30197345, 30621740, 31043579, 31424650, 31702036, 31983100, 32502299	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28537902, 36849137	Inhibit	★☆☆☆☆ Found in Text Mining only
Oxyphilic Adenoma	Oxyphilic Adenoma	BEFREE	30467700		★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	19533723, 25408199, 25746720, 30343204, 30400387		★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	30950338		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11572767, 17721921, 21479361, 25725585, 26228206, 28058630, 28339041, 28656219, 30309962, 30359541, 30595801		★☆☆☆☆ Found in Text Mining only
Pancreatic Carcinoma	Pancreatic cancer	Pubtator	20466402	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	11075989, 25677816, 31262891		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	11572767, 14669326, 16425399, 21714853, 21909380, 21931488, 22320973, 26247574, 26675757, 27721241, 27756327, 27936114, 30400136, 32186702, 33020506, 35383226	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34155232	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Acute Necrotizing	Necrotizing pancreatitis	BEFREE	30396756		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	28901486, 30964171		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	28732240		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	10961423, 11031081, 12397073, 12666099, 28585712, 29062606, 29254117, 29257285, 30019977, 30048421, 31198107, 31336695, 31612876, 31759082, 31781339		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	11031081, 12437580, 12867415, 36501032, 37051183	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	LHGDN	16505307		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	25645462	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinsonian Disorders	Parkinson Disease	BEFREE	29254117		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	30292644		★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	29230415, 34176919	Associate	★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	31596772		★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	27868136	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	39201550	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigus Vulgaris	Pemphigus Vulgaris	BEFREE	29105150		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	26782454		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	19309556, 24631628, 30593206, 35844512, 35990678	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	19948942, 24631628, 29154960, 30593206, 31032945		★☆☆☆☆ Found in Text Mining only
PEROXISOME BIOGENESIS DISORDER, COMPLEMENTATION GROUP A	Zellweger Syndrome	BEFREE	31190087		★☆☆☆☆ Found in Text Mining only
Petit mal status	Petit Mal Status	CTD_human_DG	16679645, 18571097		★☆☆☆☆ Found in Text Mining only
Peyronie Disease	Peyronie Disease	BEFREE	23356197		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	30656694, 31485933		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	26335643, 26567742		★☆☆☆☆ Found in Text Mining only
Pilomatrixoma	Pilomatrixoma	BEFREE	21048491		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	16251995, 28673204, 28983616, 28988321, 31256441		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	18073308, 33287836	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	35393909	Inhibit	★☆☆☆☆ Found in Text Mining only
Posterior subcapsular cataract	Capsular cataract	BEFREE	27623699		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	10632337, 27880058		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	11222085, 23906015		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	18077176		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	23295054, 27623699		★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	10961423		★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	28777835		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10786680, 11196158, 11221855, 11351347, 16585199, 18852124, 21668377, 22564737, 22858003, 23170075, 23726840, 24652480, 25349289, 25566960, 26877821, 27462923, 28314844, 29200739, 29392925, 30176316, 31389670		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	28327526, 37378942	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	16545117	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12771931, 15274298, 15548330, 16687488, 16880611, 19055752, 20574155, 21545229, 22564737, 22844442, 23076676, 23886135, 24267199, 26507126, 26823716, 27187384, 28415720, 28737827, 29767250, 30378157, 30864712, 31389609, 31389670, 32341393, 32427575, 34933951, 35457012, 35524874, 36364008, 36597139, 37378942, 37464317	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24375255	Inhibit	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	28704809		★☆☆☆☆ Found in Text Mining only
Prune Belly Syndrome	Prune belly syndrome	BEFREE	30950338		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	29182760		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	29182760	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	37531036	Stimulate	★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	27864821		★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	21738398		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	25058453, 30298576	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	29484832	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Edema	Pulmonary edema	Pubtator	26617708	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	15944319, 27835930, 28648907		★☆☆☆☆ Found in Text Mining only
Purpura, Thrombotic Thrombocytopenic	Thrombotic thrombocytopenic purpura	BEFREE	9840908		★☆☆☆☆ Found in Text Mining only
Raynaud Disease	Raynaud disease	Pubtator	38302542	Associate	★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	LHGDN	17908973		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	16951166, 29044596		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	12796377, 17541305, 19380190, 23759948, 27779645, 28544385, 29044596, 30179778, 30522045		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	29925521		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	30099700, 31390235		★☆☆☆☆ Found in Text Mining only
Resistance to Insulin-Like Growth Factor I	IGF-I RESISTANCE	BEFREE	30161025		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	29456694		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	22977664	Associate	★☆☆☆☆ Found in Text Mining only
Reticulosarcoma	Reticulosarcoma	BEFREE	11222085		★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal Detachment	CTD_human_DG	18497877		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Retinal Pigment Epithelial Detachment	Retinal Pigment Epithelial Detachment	CTD_human_DG	18497877		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	11959394, 19443717, 21948554, 24714974, 28138695, 29136761, 29328447, 30694025, 31038819		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	LHGDN	17616526		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	27626280, 30694025, 31038819	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid tumor	Pubtator	35613525	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	18451176, 25701753, 30067444		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	25871399	Associate	★☆☆☆☆ Found in Text Mining only
Rhegmatogenous retinal detachment	Rhegmatogenous retinal detachment	BEFREE	29568872		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	16622024, 21923740, 22990668, 23217276, 28075411, 28741869, 29544566, 29784872, 29943389, 30267788		★☆☆☆☆ Found in Text Mining only
Riboflavin Deficiency	Riboflavin deficiency	Pubtator	36014863	Stimulate	★☆☆☆☆ Found in Text Mining only
Saethre-Chotzen Syndrome	Saethre-Chotzen Syndrome	BEFREE	23943790		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	22313995	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	19155307		★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	24027049	Associate	★☆☆☆☆ Found in Text Mining only
SCAPULOPERONEAL MYOPATHY, X-LINKED DOMINANT	Scapuloperoneal Myopathy, X-Linked	BEFREE	23271051		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20580881		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	20580881		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seizures	Seizures	Pubtator	32219137	Associate	★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	10319819, 10499444, 16772874, 27227450		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	CTD_human_DG	16003065		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	26960212, 27521250, 28404559, 29240643, 29756489, 29802336, 30279549, 31520992, 31599426, 31733315		★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	BEFREE	16182592		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	17235304		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	14632209	Associate	★☆☆☆☆ Found in Text Mining only
Sialic Acid Storage Disease, Finnish Type (disorder)	Sialic Acid Storage Disease	BEFREE	27297622		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	30904000		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	10847548, 16044159, 31571864		★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	12716464, 16101145, 9473236	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	21555338	Stimulate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	23452820		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	17567922	Stimulate	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	32767507	Associate	★☆☆☆☆ Found in Text Mining only
Spermatic Cord Torsion	Spermatic Cord Torsion	BEFREE	29086205		★☆☆☆☆ Found in Text Mining only
SPHEROCYTOSIS, TYPE 1 (disorder)	Spherocytosis	BEFREE	31309362		★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	BEFREE	28786179		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	31102025		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 1	Spinocerebellar Ataxia	BEFREE	17961920		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 6 (disorder)	Spinocerebellar Ataxia	BEFREE	10674722, 11992880		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 7	Spinocerebellar Ataxia	BEFREE	11709544		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10847548, 11287285, 12101396, 14744533, 21471201, 23244104, 26935506, 27941877, 29687461, 30599074, 30663412, 30903678, 31480608, 9858879		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	18256758, 18829519		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	22136337, 28123566, 29168599, 29693138		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	14511235	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	17592646, 18349842, 18829519, 22307387, 23244104, 23271051, 25591548, 27644244, 28179290, 28257034, 28700659, 30733838, 31309556, 31356195, 33174023, 33501557, 34781814, 35078428, 36263558, 37798436	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	16651421		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	31587185		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	18829519, 22307387, 23271051, 28179290, 30182341, 30903678		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	20441052, 28700659, 28900281		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	CTD_human_DG	16679645, 18571097		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus	Status Epilepticus	BEFREE	28685385, 30039334, 30108663, 30195730, 30233331, 30823590, 30877518		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus, Subclinical	Status Epilepticus	CTD_human_DG	16679645, 18571097		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	18290776, 24106341, 29152143, 29321963, 31321239, 31618080		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	21872252		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12643601, 12854132, 12918097, 15791436, 15860933, 20530714, 24220265, 24896321, 25002346, 26779638, 26869189, 27016414, 29183726, 29393470, 29501797, 30015872, 31599422, 31802897		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	20065505, 30019295	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach Diseases	BEFREE	30572194		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	11146441, 12854132, 12918097, 12970879, 14695762, 14769213, 15222052, 16080516, 16440413, 18946358, 20032392, 21897022, 22090785, 22160140, 22799335, 23292941, 23326121, 23969976, 24805829, 24838641, 25040744, 25041019, 25197379, 25561801, 26147886, 26581978, 26686868, 26980707, 27384994, 28000850, 29393470, 29501797, 29960296, 30066897, 30719998, 30809951, 30915355, 31173270, 31599422, 32736677, 33000178, 33982777, 35757520, 36082059, 37401238, 37794689, 40076652	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	12643601, 12854132, 17698513, 18561948		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	14991928	Inhibit	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	29501797		★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	CTD_human_DG	24602480		★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	26822402, 26887383, 27844284, 28149272, 28239768, 28327595, 28337226, 28512446, 28534197, 28927047, 29258835, 29336471, 29399092, 29497296, 29592873, 29872034, 30036663, 30551525, 30717037, 30773476, 30890112, 30980845, 31599811		★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	31739654		★☆☆☆☆ Found in Text Mining only
Symmetric Diabetic Proximal Motor Neuropathy	Symmetric Diabetic Proximal Motor Neuropathy	CTD_human_DG	12502508		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	LHGDN	16802364		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	28183357		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	28138159, 30068273		★☆☆☆☆ Found in Text Mining only
Testicular Diseases	Testicular Diseases	BEFREE	29717433		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	15122333		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	17643097	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	16182592	Associate	★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	23613505, 29966585		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	21180995, 24081676, 26863116, 30964171, 32182833, 36329448	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	16962673, 21333695		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	23569377, 26934320, 31524258	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	26334619, 35968508, 37532555	Associate	★☆☆☆☆ Found in Text Mining only
TOE SYNDACTYLY, TELECANTHUS, AND ANOGENITAL AND RENAL MALFORMATIONS	Toe Syndactyly, Telecanthus, And Anogenital And Renal Malformations	BEFREE	19946756		★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	19331169, 19414420	Associate	★☆☆☆☆ Found in Text Mining only
Tonsillitis	Tonsillitis	Pubtator	19178812	Associate	★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	30588098		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26909599, 31196010, 31870109, 32847857, 33302699, 33416073, 34036395, 35447298, 37093683, 37175458, 37713894, 37822991	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28039264, 28373070, 29416635, 30428555, 30447398, 31519327		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36084486	Stimulate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	23586324	Stimulate	★☆☆☆☆ Found in Text Mining only
TUBEROUS SCLEROSIS 1 (disorder)	Tuberous Sclerosis	BEFREE	30396185		★☆☆☆☆ Found in Text Mining only
Tubular Aggregate Myopathy	Tubular Aggregate Myopathy	BEFREE	31819634		★☆☆☆☆ Found in Text Mining only
Tumoral calcinosis	Tumoral Calcinosis	CTD_human_DG	21335463		★☆☆☆☆ Found in Text Mining only
Turcot syndrome (disorder)	Turcot syndrome	BEFREE	30448733		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	CTD_human_DG	24055189		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	BEFREE	25926267		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unilateral Cryptorchidism	Cryptorchidism	CTD_human_DG	26050606		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	11346469, 18210748, 23656495, 26873485, 28191815, 28433067, 28968601, 31769229, 32277642, 37771276, 39726319	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	20025478		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	18210747, 18644986, 23152800, 24633228, 25197379, 26758418, 27363024, 27505047, 28114230, 28208804, 28438233, 28682441, 28963664, 29393414, 31180057, 31284780, 31983099, 37606138, 40603406	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	21804459, 37773689	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	12364438, 30503138		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	39321515	Associate	★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	29512749		★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	28849011, 31377879, 31670279		★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	28818228	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	20857126		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	27918592, 36334414	Associate	★☆☆☆☆ Found in Text Mining only
Venous Insufficiency	Venous insufficiency	Pubtator	29626597	Stimulate	★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Right	Ventricular dysfunction	Pubtator	28361825	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular Fibrillation	BEFREE	30986903		★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	28777835	Associate	★☆☆☆☆ Found in Text Mining only
Wiskott-Aldrich Syndrome	Wiskott-Aldrich Syndrome	BEFREE	10666201		★☆☆☆☆ Found in Text Mining only