Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	83541
Gene name	Family with sequence similarity 110 member A
Gene symbol	FAM110A
Synonyms (NCBI Gene)	C20orf55F10bA371L19.3
Chromosome	20
Chromosome location	20p13

139

Show/Hide all (139)

miRTarBase ID	miRNA	Experiments	Reference
MIRT037479	hsa-miR-744-5p	CLASH	23622248
MIRT645420	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT645418	hsa-miR-3183	HITS-CLIP	23824327
MIRT645419	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT645417	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT645416	hsa-miR-4421	HITS-CLIP	23824327
MIRT645415	hsa-miR-5699-3p	HITS-CLIP	23824327
MIRT662839	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT645410	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT645409	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT645408	hsa-miR-3120-5p	HITS-CLIP	23824327
MIRT645406	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT645404	hsa-miR-4279	HITS-CLIP	23824327
MIRT645403	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT645402	hsa-miR-6888-3p	HITS-CLIP	23824327
MIRT645401	hsa-miR-4646-3p	HITS-CLIP	23824327
MIRT645400	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT645422	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT645421	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT645420	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT645418	hsa-miR-3183	HITS-CLIP	23824327
MIRT645419	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT645417	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT645416	hsa-miR-4421	HITS-CLIP	23824327
MIRT645415	hsa-miR-5699-3p	HITS-CLIP	23824327
MIRT645414	hsa-miR-4469	HITS-CLIP	23824327
MIRT645413	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT645412	hsa-miR-4287	HITS-CLIP	23824327
MIRT645411	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT645410	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT645409	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT645408	hsa-miR-3120-5p	HITS-CLIP	23824327
MIRT645407	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT645406	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT645405	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT645404	hsa-miR-4279	HITS-CLIP	23824327
MIRT645403	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT645402	hsa-miR-6888-3p	HITS-CLIP	23824327
MIRT645401	hsa-miR-4646-3p	HITS-CLIP	23824327
MIRT645400	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT645420	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT645418	hsa-miR-3183	HITS-CLIP	23824327
MIRT645419	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT645417	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT645416	hsa-miR-4421	HITS-CLIP	23824327
MIRT645415	hsa-miR-5699-3p	HITS-CLIP	23824327
MIRT662839	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT645410	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT645409	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT645408	hsa-miR-3120-5p	HITS-CLIP	23824327
MIRT645406	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT645404	hsa-miR-4279	HITS-CLIP	23824327
MIRT645403	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT645402	hsa-miR-6888-3p	HITS-CLIP	23824327
MIRT645401	hsa-miR-4646-3p	HITS-CLIP	23824327
MIRT645400	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT645422	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT645421	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT645420	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT645418	hsa-miR-3183	HITS-CLIP	23824327
MIRT645419	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT645417	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT645416	hsa-miR-4421	HITS-CLIP	23824327
MIRT645415	hsa-miR-5699-3p	HITS-CLIP	23824327
MIRT645414	hsa-miR-4469	HITS-CLIP	23824327
MIRT645413	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT645412	hsa-miR-4287	HITS-CLIP	23824327
MIRT645411	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT645410	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT645409	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT645408	hsa-miR-3120-5p	HITS-CLIP	23824327
MIRT645407	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT645406	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT645405	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT645404	hsa-miR-4279	HITS-CLIP	23824327
MIRT645403	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT645402	hsa-miR-6888-3p	HITS-CLIP	23824327
MIRT645401	hsa-miR-4646-3p	HITS-CLIP	23824327
MIRT645400	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT977054	hsa-miR-1275	CLIP-seq
MIRT977055	hsa-miR-1470	CLIP-seq
MIRT977056	hsa-miR-1915	CLIP-seq
MIRT977057	hsa-miR-2114	CLIP-seq
MIRT977058	hsa-miR-3125	CLIP-seq
MIRT977059	hsa-miR-3166	CLIP-seq
MIRT977060	hsa-miR-330-3p	CLIP-seq
MIRT977061	hsa-miR-3908	CLIP-seq
MIRT977062	hsa-miR-3916	CLIP-seq
MIRT977063	hsa-miR-4428	CLIP-seq
MIRT977064	hsa-miR-4476	CLIP-seq
MIRT977065	hsa-miR-4477a	CLIP-seq
MIRT977066	hsa-miR-4525	CLIP-seq
MIRT977067	hsa-miR-4665-5p	CLIP-seq
MIRT977068	hsa-miR-4667-3p	CLIP-seq
MIRT977069	hsa-miR-4723-5p	CLIP-seq
MIRT977070	hsa-miR-4728-5p	CLIP-seq
MIRT977071	hsa-miR-4731-5p	CLIP-seq
MIRT977072	hsa-miR-4771	CLIP-seq
MIRT977073	hsa-miR-4779	CLIP-seq
MIRT977074	hsa-miR-545	CLIP-seq
MIRT977075	hsa-miR-555	CLIP-seq
MIRT977076	hsa-miR-625	CLIP-seq
MIRT977077	hsa-miR-765	CLIP-seq
MIRT977058	hsa-miR-3125	CLIP-seq
MIRT977062	hsa-miR-3916	CLIP-seq
MIRT977074	hsa-miR-545	CLIP-seq
MIRT1989555	hsa-miR-1224-5p	CLIP-seq
MIRT1989556	hsa-miR-128	CLIP-seq
MIRT1989557	hsa-miR-27a	CLIP-seq
MIRT1989558	hsa-miR-27b	CLIP-seq
MIRT1989559	hsa-miR-3123	CLIP-seq
MIRT1989560	hsa-miR-3150a-3p	CLIP-seq
MIRT1989561	hsa-miR-3150b-3p	CLIP-seq
MIRT1989562	hsa-miR-3175	CLIP-seq
MIRT977060	hsa-miR-330-3p	CLIP-seq
MIRT1989563	hsa-miR-3616-3p	CLIP-seq
MIRT1989564	hsa-miR-3915	CLIP-seq
MIRT1989565	hsa-miR-3925-5p	CLIP-seq
MIRT1989566	hsa-miR-4462	CLIP-seq
MIRT977064	hsa-miR-4476	CLIP-seq
MIRT1989567	hsa-miR-4685-5p	CLIP-seq
MIRT1989568	hsa-miR-4689	CLIP-seq
MIRT1989569	hsa-miR-4696	CLIP-seq
MIRT977070	hsa-miR-4728-5p	CLIP-seq
MIRT1989570	hsa-miR-4784	CLIP-seq
MIRT1989571	hsa-miR-491-5p	CLIP-seq
MIRT1989572	hsa-miR-518d-5p	CLIP-seq
MIRT1989573	hsa-miR-519b-5p	CLIP-seq
MIRT1989574	hsa-miR-519c-5p	CLIP-seq
MIRT1989575	hsa-miR-520c-5p	CLIP-seq
MIRT1989576	hsa-miR-526a	CLIP-seq
MIRT1989577	hsa-miR-939	CLIP-seq
MIRT2223901	hsa-miR-3152-5p	CLIP-seq
MIRT2223902	hsa-miR-3156-5p	CLIP-seq
MIRT2223903	hsa-miR-3607-3p	CLIP-seq
MIRT2223904	hsa-miR-3686	CLIP-seq
MIRT2223905	hsa-miR-3934	CLIP-seq
MIRT1989567	hsa-miR-4685-5p	CLIP-seq
MIRT1989569	hsa-miR-4696	CLIP-seq

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000922	Component	Spindle pole	IDA	34080749
GO:0000922	Component	Spindle pole	IEA
GO:0005515	Function	Protein binding	IPI	17474147, 21900206, 21988832, 25416956, 30886144, 32296183, 32707033
GO:0005634	Component	Nucleus	IDA	34080749
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	34080749
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IDA	34080749
GO:0005829	Component	Cytosol	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005876	Component	Spindle microtubule	IDA	34080749
GO:0005876	Component	Spindle microtubule	IEA
GO:0005938	Component	Cell cortex	IEA
GO:0005938	Component	Cell cortex	ISS
GO:0007052	Process	Mitotic spindle organization	IMP	34080749

MIM	HGNC	e!Ensembl
611393	16188	ENSG00000125898

Q9BQ89

Protein name

Protein FAM110A

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14161	FAM110_N	4 → 103	Centrosome-associated N terminus	Family
PF14160	FAM110_C	181 → 287	Centrosome-associated C terminus	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in thyroid, lymph node, trachea, adrenal gland, bone marrow, spleen, thymus, prostate, and peripheral blood leukocyte. Detected at lower levels in stomach, testis and spinal cord. {ECO:0000269|PubMed:17499476}.

Sequence

MPVHTLSPGAPSAPALPCRLRTRVPGYLLRGPADGGARKPSAVERLEADKAKYVKSLHVA
NTRQEPVQPLLSKQPLFSPETRRTVLTPSRRALPGPCRRPQLDLDILSSLIDLCDSPVSP
AEASRTPGRAEGAGRPPPATPPRPPPSTSAVRRVDVRPLPASPARPCPSPGPAAASSPAR
PPGLQRSKSDLSERFSRAAADLERFFNFCGLDPEEARGLGVAHLARASSDIVSLAGPSAG
PGSSEGGCSRRSSVTVEERARERVPYGVSVVERNARVIKWLYGLRQARESPAAEG

Sequence length

295

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (174)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Activated Protein C Resistance	Activated Protein C Resistance	BEFREE	16138341, 16601846, 22044617, 28287382, 28318106, 8578503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	25155499, 28940408, 29588304, 30103248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	20634491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	11248282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	29550835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	23604512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	30518218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	28551028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	28569372, 30990095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	BEFREE	28883515, 29126301, 31635559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antithrombin III Deficiency	Antithrombin deficiency	Pubtator	37670493	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	28220880, 29571622, 31526123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	28735510	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	30944221, 31526123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic valve calcification	Aortic valve calcification	BEFREE	29847020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	12160678, 28220880, 30846818, 31010298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	17082493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	12160678, 28220880, 30846818, 31010298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	23137705	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	24041930, 33185476, 37203300	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	27811198, 27817212, 28077507, 28238163, 28283738, 28302288, 28373761, 28412907, 28512699, 28595862, 28650000, 28666993, 28708713, 28760063, 28769809 View all (33 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	19389935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bare Lymphocyte Syndrome	Bare Lymphocyte Syndrome	BEFREE	10825209, 9190936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bare lymphocyte syndrome 2	Bare Lymphocyte Syndrome	BEFREE	10825209, 9190936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behavioral tic	Tourette syndrome	BEFREE	28694557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	30499073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	11246545, 11728527, 12161341, 16424563, 16487577, 18245654, 1939653, 1950377, 19598069, 19710607, 1973167, 22020385, 22931370, 25179519, 25582404 View all (15 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	17509570, 20864578, 24127605, 25811371, 34696334, 37024459	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	CTD_human_DG	62897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders, Inherited	Blood Coagulation Disorders	BEFREE	12437661, 24393662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25447311, 30929299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	14717972, 25407022	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36923407, 8381308	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31718609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	31401971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	28238163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	27811198, 27817212, 27881569, 27881833, 28077507, 28232327, 28337024, 28512699, 28595862, 28650000, 28703931, 28805310, 28843518, 28862934, 29105079 View all (17 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	39831920	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29105079, 30022146, 31450643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	20438701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coagulation factor deficiency syndrome	Coagulation Factor Deficiency Syndrome	BEFREE	17762534, 18081833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital factor X deficiency	Congenital Factor X Deficiency	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28666993, 31356557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	28703931, 29700120, 29720261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	19572077, 25155499, 29720261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	25155499, 29720261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	3010714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	27292781, 28239036, 28769809, 29419408, 29934383, 30193575, 30431004, 30685261, 30772162, 30990095, 31089975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	26761945, 31371788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	26761945, 31371788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	34494136	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	10775023	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	27283743, 30814628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	BEFREE	11815293, 28288667, 28439967, 31397594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	31331004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysfibrinogenemia	Dysfibrinogenemia	BEFREE	14995986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	11554693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	31028196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	31028196	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	23658376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	31718609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	BEFREE	9622212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Factor V deficiency	Factor V Deficiency	BEFREE	3804320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Factor VII Deficiency	Factor VII Deficiency	BEFREE	26891460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Factor X Deficiency	Factor X Deficiency	UNIPROT_DG	10468877, 10739379, 10746568, 11248282, 11728527, 12574802, 12945883, 15075089, 15650540, 17393015, 19135706, 1973167, 1985698, 25313940, 26222694 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Factor X Deficiency	Factor X Deficiency	CLINGEN_DG	10739370, 10746568, 18036190, 1939653, 1985698, 22931370, 27626380, 2790181, 30036279, 30507709, 3286010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Factor X Deficiency	Factor X Deficiency	BEFREE	10739379, 10746568, 11345209, 15060750, 15075089, 15892863, 16424563, 18036190, 18245654, 19404516, 26891460, 2790181, 30782860, 3970856, 7233424, 9531027 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Factor X Deficiency	Factor X Deficiency	ORPHANET_DG	15892863, 26222694, 26309706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Factor X Deficiency	Factor x deficiency	Pubtator	15892863, 23677006, 26708756, 28302935, 34680916, 37678549	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Factor X Deficiency	Factor X Deficiency	LHGDN	18245654, 18403394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Factor X Deficiency	Factor X Deficiency	GENOMICS_ENGLAND_DG	9198147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Factor X Deficiency	Factor X Deficiency	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Factor X Deficiency	Factor X Deficiency	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrinogen Deficiency	Fibrinogen Deficiency	BEFREE	14995986, 9697871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	29739329, 30719803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Genetic Predisposition to Disease	Genetic predisposition to disease	Pubtator	14521598	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10606759, 30034397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10606759, 30034397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22160665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	1730083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	23604512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28666993, 31356557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart valve disease	Cardiac valvular disease	BEFREE	28302288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	7688991	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	22020385, 27480904, 28691557, 28932824, 30320649, 30344994, 30451376, 31348595, 31639831, 31699786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia, NOS	Hemophilia	BEFREE	22020385, 27480904, 28932824, 30320649, 31639831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	23677006, 27975099, 28302935, 37203300	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	29588304	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Antithrombin Deficiency	Antithrombin Deficiency	BEFREE	8470046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary factor II deficiency disease	Hereditary Factor II Deficiency Disease	BEFREE	10627484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Factor V Deficiency	Hereditary Factor V Deficiency	BEFREE	3804320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary factor X deficiency disease	Hereditary Factor X Deficiency Disease	BEFREE	10468877, 15650540, 1973167, 29460388, 29707881, 30507709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary factor X deficiency disease	Hereditary Factor X Deficiency Disease	CLINGEN_DG	10739370, 10746568, 18036190, 1939653, 1985698, 22931370, 27626380, 2790181, 30036279, 30507709, 3286010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Factor XIII Deficiency	Hereditary Factor XIII Deficiency	BEFREE	23109366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	31352829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypofibrinogenemia	Hypofibrinogenemia	BEFREE	9697871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	LHGDN	18591887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31580221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28283478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	31580221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic Attack Transient	Transient ischemic attack	Pubtator	29385837	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	31450643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	31361865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	28808989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus anticoagulant disorder	Lupus anticoagulant	BEFREE	29126301, 31487115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	28883515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	28883515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28883515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	28883515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	1950377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	25303152	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25447311, 30929299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	31028196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29656167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28714376, 29284351, 29304537, 29341163, 29411223, 29661489, 30075504, 31382462, 31685262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	3970856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16894464, 18031796, 18612547		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15567463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	31877279	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple endocrine neoplasia Type 2	Multiple Endocrine Neoplasia	BEFREE	29341163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	30114681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28992973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	11991237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	15550696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	25155499, 28077507, 28666993, 28862934, 29249166, 29748353, 29843086, 30236308, 30321554, 30540648, 30586727, 31352829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	31699787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial necrosis	Myocardial necrosis	BEFREE	29249166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	35271862	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15668516, 22160665, 22925132, 24158387, 25496996, 29411223, 31086333, 31541031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis, Interstitial	Nephritis	BEFREE	30022146		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis, Tubulointerstitial	Nephritis	BEFREE	30022146		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	29292076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10606759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29562231		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	BEFREE	27661794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	17509570	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29656167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	31393055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	36923407	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	31285632	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	31144674, 31285632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	31144674		★★★★★ ★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	23604512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Platelet Storage Pool Deficiency	Platelet Storage Pool Deficiency	BEFREE	3718874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	11991237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Portal Vein Thrombosis	Portal Vein Thrombosis	BEFREE	29049216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	11248282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	23604512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Protein C Deficiency	Protein C Deficiency	BEFREE	6897135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	31877279	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31831767		★★★★★ ★☆☆☆☆ Found in Text Mining only
RETINOSCHISIS 1, X-LINKED, JUVENILE	Retinoschisis, X-Linked	BEFREE	30796650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28767591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	16595856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	11685190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spontaneous hematomas	Hematomas	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	21114618	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombasthenia	Thrombasthenia	BEFREE	3718874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	11991237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	Pubtator	10942390	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	11434677, 28580443, 29100817, 29378360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	23137705, 23677006, 24104188, 26826018, 27975099, 28735510, 29879041, 37024459	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tic disorder	Tic Disorder	BEFREE	28694557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tomaculous neuropathy	Hereditary neuropathy with liability to pressure palsies	Pubtator	25179519, 34680916	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	28238163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	28238163, 29385837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	18081833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	39372720	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	32679199	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	25041869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	22044617	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	27975099	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	29341163		★★★★★ ★☆☆☆☆ Found in Text Mining only

FAM110A (family with sequence similarity 110 member A)