Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	83482
Gene name	Scratch family transcriptional repressor 1
Gene symbol	SCRT1
Synonyms (NCBI Gene)	SCRTZNF898
Chromosome	8
Chromosome location	8q24.3
Summary	This gene encodes a C2H2-type zinc finger transcriptional repressor that binds to E-box motifs. The encoded protein may promote neural differention and may be involved in cancers with neuroendocrine features. [provided by RefSeq, Jul 2013]

Show/Hide all (96)

miRTarBase ID	miRNA	Experiments	Reference
MIRT723352	hsa-miR-362-5p	HITS-CLIP	19536157
MIRT723351	hsa-miR-500b-5p	HITS-CLIP	19536157
MIRT723350	hsa-miR-5196-3p	HITS-CLIP	19536157
MIRT723349	hsa-miR-4793-5p	HITS-CLIP	19536157
MIRT723348	hsa-miR-6786-5p	HITS-CLIP	19536157
MIRT723347	hsa-miR-6769a-5p	HITS-CLIP	19536157
MIRT723346	hsa-miR-6769b-5p	HITS-CLIP	19536157
MIRT723345	hsa-miR-491-5p	HITS-CLIP	19536157
MIRT723344	hsa-miR-3151-5p	HITS-CLIP	19536157
MIRT723342	hsa-miR-4447	HITS-CLIP	19536157
MIRT723343	hsa-miR-4472	HITS-CLIP	19536157
MIRT723341	hsa-miR-6742-5p	HITS-CLIP	19536157
MIRT723340	hsa-miR-4265	HITS-CLIP	19536157
MIRT723339	hsa-miR-4296	HITS-CLIP	19536157
MIRT723338	hsa-miR-4322	HITS-CLIP	19536157
MIRT723337	hsa-miR-6796-5p	HITS-CLIP	19536157
MIRT723336	hsa-miR-6759-5p	HITS-CLIP	19536157
MIRT723352	hsa-miR-362-5p	HITS-CLIP	19536157
MIRT723351	hsa-miR-500b-5p	HITS-CLIP	19536157
MIRT723350	hsa-miR-5196-3p	HITS-CLIP	19536157
MIRT723349	hsa-miR-4793-5p	HITS-CLIP	19536157
MIRT723348	hsa-miR-6786-5p	HITS-CLIP	19536157
MIRT723347	hsa-miR-6769a-5p	HITS-CLIP	19536157
MIRT723346	hsa-miR-6769b-5p	HITS-CLIP	19536157
MIRT723345	hsa-miR-491-5p	HITS-CLIP	19536157
MIRT723344	hsa-miR-3151-5p	HITS-CLIP	19536157
MIRT723342	hsa-miR-4447	HITS-CLIP	19536157
MIRT723343	hsa-miR-4472	HITS-CLIP	19536157
MIRT723341	hsa-miR-6742-5p	HITS-CLIP	19536157
MIRT723340	hsa-miR-4265	HITS-CLIP	19536157
MIRT723339	hsa-miR-4296	HITS-CLIP	19536157
MIRT723338	hsa-miR-4322	HITS-CLIP	19536157
MIRT723337	hsa-miR-6796-5p	HITS-CLIP	19536157
MIRT723336	hsa-miR-6759-5p	HITS-CLIP	19536157
MIRT1330885	hsa-miR-1205	CLIP-seq
MIRT1330886	hsa-miR-1207-5p	CLIP-seq
MIRT1330887	hsa-miR-1294	CLIP-seq
MIRT1330888	hsa-miR-1909	CLIP-seq
MIRT1330889	hsa-miR-3151	CLIP-seq
MIRT1330890	hsa-miR-342-5p	CLIP-seq
MIRT1330891	hsa-miR-3675-5p	CLIP-seq
MIRT1330892	hsa-miR-4283	CLIP-seq
MIRT1330893	hsa-miR-4489	CLIP-seq
MIRT1330894	hsa-miR-4651	CLIP-seq
MIRT1330895	hsa-miR-4664-5p	CLIP-seq
MIRT1330896	hsa-miR-4707-3p	CLIP-seq
MIRT1330897	hsa-miR-4710	CLIP-seq
MIRT1330898	hsa-miR-4730	CLIP-seq
MIRT1330899	hsa-miR-4747-3p	CLIP-seq
MIRT1330900	hsa-miR-4763-3p	CLIP-seq
MIRT1330901	hsa-miR-4779	CLIP-seq
MIRT1330902	hsa-miR-512-5p	CLIP-seq
MIRT1330903	hsa-miR-604	CLIP-seq
MIRT1330904	hsa-miR-608	CLIP-seq
MIRT1330905	hsa-miR-647	CLIP-seq
MIRT1330906	hsa-miR-765	CLIP-seq
MIRT1330907	hsa-miR-940	CLIP-seq
MIRT1553252	hsa-miR-3184	CLIP-seq
MIRT1553253	hsa-miR-423-5p	CLIP-seq
MIRT1553254	hsa-miR-4728-5p	CLIP-seq
MIRT1921381	hsa-miR-125a-5p	CLIP-seq
MIRT1921382	hsa-miR-125b	CLIP-seq
MIRT1921383	hsa-miR-4319	CLIP-seq
MIRT1921384	hsa-miR-4732-3p	CLIP-seq
MIRT1921385	hsa-miR-670	CLIP-seq
MIRT2097882	hsa-miR-296-5p	CLIP-seq
MIRT2097883	hsa-miR-3907	CLIP-seq
MIRT1330901	hsa-miR-4779	CLIP-seq
MIRT2097884	hsa-miR-887	CLIP-seq
MIRT2322368	hsa-miR-1207-3p	CLIP-seq
MIRT2322369	hsa-miR-3135b	CLIP-seq
MIRT2322370	hsa-miR-3649	CLIP-seq
MIRT2097883	hsa-miR-3907	CLIP-seq
MIRT2322371	hsa-miR-4308	CLIP-seq
MIRT2097884	hsa-miR-887	CLIP-seq
MIRT2394103	hsa-miR-1913	CLIP-seq
MIRT2394104	hsa-miR-3064-5p	CLIP-seq
MIRT2394105	hsa-miR-324-3p	CLIP-seq
MIRT2394106	hsa-miR-331-3p	CLIP-seq
MIRT2394107	hsa-miR-3652	CLIP-seq
MIRT2097883	hsa-miR-3907	CLIP-seq
MIRT2394108	hsa-miR-4430	CLIP-seq
MIRT2394109	hsa-miR-4505	CLIP-seq
MIRT2394110	hsa-miR-4638-3p	CLIP-seq
MIRT2394111	hsa-miR-4749-3p	CLIP-seq
MIRT2618642	hsa-miR-3620	CLIP-seq
MIRT2097883	hsa-miR-3907	CLIP-seq
MIRT2618643	hsa-miR-4254	CLIP-seq
MIRT2322371	hsa-miR-4308	CLIP-seq
MIRT1553254	hsa-miR-4728-5p	CLIP-seq
MIRT2618642	hsa-miR-3620	CLIP-seq
MIRT2097883	hsa-miR-3907	CLIP-seq
MIRT2618643	hsa-miR-4254	CLIP-seq
MIRT2322371	hsa-miR-4308	CLIP-seq
MIRT1553254	hsa-miR-4728-5p	CLIP-seq
MIRT2097884	hsa-miR-887	CLIP-seq

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	11274425
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	11274425
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	11274425
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	NAS	11274425
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0006355	Process	Regulation of DNA-templated transcription	TAS	11274425
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0043565	Function	Sequence-specific DNA binding	IDA	23332764
GO:0046872	Function	Metal ion binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2001222	Process	Regulation of neuron migration	IEA

MIM	HGNC	e!Ensembl
605858	15950	ENSG00000261678

Q9BWW7

Protein name

Transcriptional repressor scratch 1 (Scratch homolog 1 zinc finger protein) (SCRT) (Scratch 1) (hScrt)

Protein function

Transcriptional repressor that binds E-box motif CAGGTG. Can modulate the action of basic helix-loop-helix (bHLH) transcription factors, critical for neuronal differentiation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	191 → 213	Zinc finger, C2H2 type	Domain
PF13912	zf-C2H2_6	221 → 245		Domain
PF00096	zf-C2H2	248 → 270	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	276 → 298	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	304 → 325	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Brain specific. {ECO:0000269|PubMed:11274425}.

Sequence

MPRSFLVKKVKLDAFSSADLESAYGRARSDLGAPLHDKGYLSDYVGPSSVYDGDAEAALL
KGPSPEPMYAAAVRGELGPAAAGSAPPPTPRPELATAAGGYINGDAAVSEGYAADAFFIT
DGRSRRKASNAGSAAAPSTASAAAPDGDAGGGGGAGGRSLGSGPGGRGGTRAGAGTEARA
GPGAAGAGGRHACGECGKTYATSSNLSRHKQTHRSLDSQLARRCPTCGKVYVSMPAMAMH
LLTHDLRHKCGVCGKAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLRAHMQTHSA
FKHFQCKRCKKSFALKSYLNKHYESACFKGGAGGPAAPAPPQLSPVQA

Sequence length

348

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma	Carcinoma	BEFREE	20043117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Compression of spinal cord	Spinal cord compression	BEFREE	29494653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	29631562	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	20043117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20043117		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	20043117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20043117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	31426827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligodendroglioma	Oligodendroglioma	Pubtator	29631562	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SCRT1 (scratch family transcriptional repressor 1)