Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	83463
Gene name	MAX dimerization protein 3
Gene symbol	MXD3
Synonyms (NCBI Gene)	BHLHC13MAD3MYX
Chromosome	5
Chromosome location	5q35.3
Summary	This gene encodes a member of the Myc superfamily of basic helix-loop-helix leucine zipper transcriptional regulators. The encoded protein forms a heterodimer with the cofactor MAX which binds specific E-box DNA motifs in the promoters of target genes and

Show/Hide all (45)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050655	hsa-miR-18a-5p	CLASH	23622248
MIRT1166989	hsa-miR-135a	CLIP-seq
MIRT1166990	hsa-miR-135b	CLIP-seq
MIRT1166991	hsa-miR-548ad	CLIP-seq
MIRT1166992	hsa-miR-578	CLIP-seq
MIRT1166993	hsa-miR-1183	CLIP-seq
MIRT1166994	hsa-miR-1205	CLIP-seq
MIRT1166995	hsa-miR-1207-5p	CLIP-seq
MIRT1166996	hsa-miR-1294	CLIP-seq
MIRT1166997	hsa-miR-146b-3p	CLIP-seq
MIRT1166998	hsa-miR-1827	CLIP-seq
MIRT1166999	hsa-miR-1909	CLIP-seq
MIRT1167000	hsa-miR-200b	CLIP-seq
MIRT1167001	hsa-miR-200c	CLIP-seq
MIRT1167002	hsa-miR-22	CLIP-seq
MIRT1167003	hsa-miR-3119	CLIP-seq
MIRT1167004	hsa-miR-3173-5p	CLIP-seq
MIRT1167005	hsa-miR-3188	CLIP-seq
MIRT1167006	hsa-miR-3647-3p	CLIP-seq
MIRT1167007	hsa-miR-3714	CLIP-seq
MIRT1167008	hsa-miR-429	CLIP-seq
MIRT1167009	hsa-miR-4312	CLIP-seq
MIRT1167010	hsa-miR-4316	CLIP-seq
MIRT1167011	hsa-miR-4501	CLIP-seq
MIRT1167012	hsa-miR-4763-3p	CLIP-seq
MIRT1167013	hsa-miR-4763-5p	CLIP-seq
MIRT1167014	hsa-miR-548an	CLIP-seq
MIRT1167015	hsa-miR-582-5p	CLIP-seq
MIRT1167016	hsa-miR-874	CLIP-seq
MIRT1167017	hsa-miR-940	CLIP-seq
MIRT1166999	hsa-miR-1909	CLIP-seq
MIRT2048229	hsa-miR-2110	CLIP-seq
MIRT2048230	hsa-miR-3150a-3p	CLIP-seq
MIRT2048231	hsa-miR-3175	CLIP-seq
MIRT2048232	hsa-miR-4722-3p	CLIP-seq
MIRT1167013	hsa-miR-4763-5p	CLIP-seq
MIRT2048233	hsa-miR-939	CLIP-seq
MIRT2277100	hsa-miR-4289	CLIP-seq
MIRT1166991	hsa-miR-548ad	CLIP-seq
MIRT2277101	hsa-miR-548p	CLIP-seq
MIRT2277102	hsa-miR-653	CLIP-seq
MIRT2391205	hsa-miR-4493	CLIP-seq
MIRT2391206	hsa-miR-615-3p	CLIP-seq
MIRT2685580	hsa-miR-140-3p	CLIP-seq
MIRT2685581	hsa-miR-3065-3p	CLIP-seq

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 31515488, 32296183, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0046983	Function	Protein dimerization activity	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IEA

MIM	HGNC	e!Ensembl
609450	14008	ENSG00000213347

Q9BW11

Protein name

Max dimerization protein 3 (Max dimerizer 3) (Class C basic helix-loop-helix protein 13) (bHLHc13) (Max-associated protein 3) (Max-interacting transcriptional repressor MAD3) (Myx)

Protein function

Transcriptional repressor. Binds with MAX to form a sequence-specific DNA-binding protein complex which recognizes the core sequence 5'-CAC[GA]TG-3'. Antagonizes MYC transcriptional activity by competing for MAX and suppresses MYC dependent cell

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	58 → 110	Helix-loop-helix DNA-binding domain	Domain

Sequence

MEPLASNIQVLLQAAEFLERREREAEHGYASLCPHRSPGPIHRRKKRPPQAPGAQDSGRS
VHNELEKRRRAQLKRCLERLKQQMPLGADCARYTTLSLLRRARMHIQKLEDQEQRARQLK
ERLRSKQQSLQRQLEQLRGLAGAAERERLRADSLDSSGLSSERSDSDQEELEVDVESLVF
GGEAELLRGFVAGQEHSYSHGGGAWL

Sequence length

206

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (18)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	25196579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	18235219, 22808009, 25053245, 25554682, 30838212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	18235219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36524545	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	18235219, 22808009, 25053245, 25554682, 30838212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	28337255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30838212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30838212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30838212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	18235219, 22808009, 25053245, 25554682, 30838212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	22808009	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	22808009, 25554682	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular angina	Pubtator	36524545	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28419087, 31783139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	28419087, 31783139	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	28804122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	39287260	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

MXD3 (MAX dimerization protein 3)