Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	83461
Gene name	Cell division cycle associated 3
Gene symbol	CDCA3
Synonyms (NCBI Gene)	GRCC8TOME-1TOME1
Chromosome	12
Chromosome location	12p13.31

125

Show/Hide all (125)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029492	hsa-miR-26b-5p	Microarray	19088304
MIRT051450	hsa-let-7e-5p	CLASH	23622248
MIRT044752	hsa-miR-320a	CLASH	23622248
MIRT451819	hsa-miR-3936	PAR-CLIP	23446348
MIRT451818	hsa-miR-3154	PAR-CLIP	23446348
MIRT508360	hsa-miR-1197	PAR-CLIP	23446348
MIRT451817	hsa-miR-6782-5p	PAR-CLIP	23446348
MIRT451812	hsa-miR-4308	PAR-CLIP	23446348
MIRT451811	hsa-miR-4292	PAR-CLIP	23446348
MIRT451810	hsa-miR-6791-5p	PAR-CLIP	23446348
MIRT451809	hsa-miR-204-3p	PAR-CLIP	23446348
MIRT451808	hsa-miR-4646-5p	PAR-CLIP	23446348
MIRT451807	hsa-miR-3179	PAR-CLIP	23446348
MIRT451806	hsa-miR-5004-5p	PAR-CLIP	23446348
MIRT451804	hsa-miR-4668-5p	PAR-CLIP	23446348
MIRT451803	hsa-miR-3153	PAR-CLIP	23446348
MIRT451802	hsa-miR-6733-5p	PAR-CLIP	23446348
MIRT451801	hsa-miR-6739-5p	PAR-CLIP	23446348
MIRT451819	hsa-miR-3936	PAR-CLIP	23446348
MIRT451818	hsa-miR-3154	PAR-CLIP	23446348
MIRT508360	hsa-miR-1197	PAR-CLIP	23446348
MIRT451817	hsa-miR-6782-5p	PAR-CLIP	23446348
MIRT451816	hsa-miR-188-5p	PAR-CLIP	23446348
MIRT451815	hsa-miR-6866-3p	PAR-CLIP	23446348
MIRT451812	hsa-miR-4308	PAR-CLIP	23446348
MIRT451811	hsa-miR-4292	PAR-CLIP	23446348
MIRT451810	hsa-miR-6791-5p	PAR-CLIP	23446348
MIRT451809	hsa-miR-204-3p	PAR-CLIP	23446348
MIRT451808	hsa-miR-4646-5p	PAR-CLIP	23446348
MIRT451807	hsa-miR-3179	PAR-CLIP	23446348
MIRT451806	hsa-miR-5004-5p	PAR-CLIP	23446348
MIRT451804	hsa-miR-4668-5p	PAR-CLIP	23446348
MIRT451803	hsa-miR-3153	PAR-CLIP	23446348
MIRT451802	hsa-miR-6733-5p	PAR-CLIP	23446348
MIRT451801	hsa-miR-6739-5p	PAR-CLIP	23446348
MIRT451819	hsa-miR-3936	PAR-CLIP	23592263
MIRT451818	hsa-miR-3154	PAR-CLIP	23592263
MIRT451817	hsa-miR-6782-5p	PAR-CLIP	23592263
MIRT451816	hsa-miR-188-5p	PAR-CLIP	23592263
MIRT451815	hsa-miR-6866-3p	PAR-CLIP	23592263
MIRT451814	hsa-miR-1226-3p	PAR-CLIP	23592263
MIRT451813	hsa-miR-4733-3p	PAR-CLIP	23592263
MIRT451812	hsa-miR-4308	PAR-CLIP	23592263
MIRT451811	hsa-miR-4292	PAR-CLIP	23592263
MIRT451810	hsa-miR-6791-5p	PAR-CLIP	23592263
MIRT451809	hsa-miR-204-3p	PAR-CLIP	23592263
MIRT451808	hsa-miR-4646-5p	PAR-CLIP	23592263
MIRT451807	hsa-miR-3179	PAR-CLIP	23592263
MIRT451806	hsa-miR-5004-5p	PAR-CLIP	23592263
MIRT451805	hsa-miR-144-5p	PAR-CLIP	23592263
MIRT451804	hsa-miR-4668-5p	PAR-CLIP	23592263
MIRT451803	hsa-miR-3153	PAR-CLIP	23592263
MIRT451802	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT451801	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT451819	hsa-miR-3936	PAR-CLIP	23446348
MIRT451818	hsa-miR-3154	PAR-CLIP	23446348
MIRT508360	hsa-miR-1197	PAR-CLIP	23446348
MIRT451817	hsa-miR-6782-5p	PAR-CLIP	23446348
MIRT451812	hsa-miR-4308	PAR-CLIP	23446348
MIRT451811	hsa-miR-4292	PAR-CLIP	23446348
MIRT451810	hsa-miR-6791-5p	PAR-CLIP	23446348
MIRT451809	hsa-miR-204-3p	PAR-CLIP	23446348
MIRT451808	hsa-miR-4646-5p	PAR-CLIP	23446348
MIRT451807	hsa-miR-3179	PAR-CLIP	23446348
MIRT451806	hsa-miR-5004-5p	PAR-CLIP	23446348
MIRT451804	hsa-miR-4668-5p	PAR-CLIP	23446348
MIRT451803	hsa-miR-3153	PAR-CLIP	23446348
MIRT451802	hsa-miR-6733-5p	PAR-CLIP	23446348
MIRT451801	hsa-miR-6739-5p	PAR-CLIP	23446348
MIRT451819	hsa-miR-3936	PAR-CLIP	23446348
MIRT451818	hsa-miR-3154	PAR-CLIP	23446348
MIRT508360	hsa-miR-1197	PAR-CLIP	23446348
MIRT451817	hsa-miR-6782-5p	PAR-CLIP	23446348
MIRT451816	hsa-miR-188-5p	PAR-CLIP	23446348
MIRT451815	hsa-miR-6866-3p	PAR-CLIP	23446348
MIRT451812	hsa-miR-4308	PAR-CLIP	23446348
MIRT451811	hsa-miR-4292	PAR-CLIP	23446348
MIRT451810	hsa-miR-6791-5p	PAR-CLIP	23446348
MIRT451809	hsa-miR-204-3p	PAR-CLIP	23446348
MIRT451808	hsa-miR-4646-5p	PAR-CLIP	23446348
MIRT451807	hsa-miR-3179	PAR-CLIP	23446348
MIRT451806	hsa-miR-5004-5p	PAR-CLIP	23446348
MIRT451804	hsa-miR-4668-5p	PAR-CLIP	23446348
MIRT451803	hsa-miR-3153	PAR-CLIP	23446348
MIRT451802	hsa-miR-6733-5p	PAR-CLIP	23446348
MIRT451801	hsa-miR-6739-5p	PAR-CLIP	23446348
MIRT451819	hsa-miR-3936	PAR-CLIP	23592263
MIRT451818	hsa-miR-3154	PAR-CLIP	23592263
MIRT451817	hsa-miR-6782-5p	PAR-CLIP	23592263
MIRT451816	hsa-miR-188-5p	PAR-CLIP	23592263
MIRT451815	hsa-miR-6866-3p	PAR-CLIP	23592263
MIRT451814	hsa-miR-1226-3p	PAR-CLIP	23592263
MIRT451813	hsa-miR-4733-3p	PAR-CLIP	23592263
MIRT451812	hsa-miR-4308	PAR-CLIP	23592263
MIRT451811	hsa-miR-4292	PAR-CLIP	23592263
MIRT451810	hsa-miR-6791-5p	PAR-CLIP	23592263
MIRT451809	hsa-miR-204-3p	PAR-CLIP	23592263
MIRT451808	hsa-miR-4646-5p	PAR-CLIP	23592263
MIRT451807	hsa-miR-3179	PAR-CLIP	23592263
MIRT451806	hsa-miR-5004-5p	PAR-CLIP	23592263
MIRT451805	hsa-miR-144-5p	PAR-CLIP	23592263
MIRT451804	hsa-miR-4668-5p	PAR-CLIP	23592263
MIRT451803	hsa-miR-3153	PAR-CLIP	23592263
MIRT451802	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT451801	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT878753	hsa-miR-1226	CLIP-seq
MIRT878754	hsa-miR-320b	CLIP-seq
MIRT878755	hsa-miR-320c	CLIP-seq
MIRT878756	hsa-miR-320d	CLIP-seq
MIRT878757	hsa-miR-4429	CLIP-seq
MIRT878758	hsa-miR-4677-3p	CLIP-seq
MIRT878759	hsa-miR-4797-3p	CLIP-seq
MIRT878760	hsa-miR-570	CLIP-seq
MIRT878754	hsa-miR-320b	CLIP-seq
MIRT878755	hsa-miR-320c	CLIP-seq
MIRT878756	hsa-miR-320d	CLIP-seq
MIRT878757	hsa-miR-4429	CLIP-seq
MIRT878759	hsa-miR-4797-3p	CLIP-seq
MIRT2385829	hsa-miR-3150b-3p	CLIP-seq
MIRT2385830	hsa-miR-33a	CLIP-seq
MIRT2385831	hsa-miR-33b	CLIP-seq
MIRT2385832	hsa-miR-4294	CLIP-seq
MIRT2385833	hsa-miR-4689	CLIP-seq
MIRT2385834	hsa-miR-4784	CLIP-seq
MIRT2385835	hsa-miR-765	CLIP-seq

Show/Hide all (6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 25416956, 27880917, 28514442, 31515488, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005912	Component	Adherens junction	IDA	25468996
GO:0016567	Process	Protein ubiquitination	IEA
GO:0051301	Process	Cell division	IEA

MIM	HGNC	e!Ensembl
607749	14624	ENSG00000111665

Q99618

Protein name

Cell division cycle-associated protein 3 (Gene-rich cluster protein C8) (Trigger of mitotic entry protein 1) (TOME-1)

Protein function

F-box-like protein which is required for entry into mitosis. Acts by participating in E3 ligase complexes that mediate the ubiquitination and degradation of WEE1 kinase at G2/M phase (By similarity).

Family and domains

Sequence

MGSAKSVPVTPARPPPHNKHLARVADPRSPSAGILRTPIQVESSPQPGLPAGEQLEGLKH
AQDSDPRSPTLGIARTPMKTSSGDPPSPLVKQLSEVFETEDSKSNLPPEPVLPPEAPLSS
ELDLPLGTQLSVEEQMPPWNQTEFPSKQVFSKEEARQPTETPVASQSSDKPSRDPETPRS
SGSMRNRWKPNSSKVLGRSPLTILQDDNSPGTLTLRQGKRPSPLSENVSELKEGAILGTG
RLLKTGGRAWEQGQDHDKENQHFPLVES

Sequence length

268

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EYE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NIGHT BLINDNESS, CONGENITAL STATIONARY, TYPE 1H	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (27)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinogenesis	Carcinogenesis	Pubtator	22839099, 25236463, 33604380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25236463, 33604380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34699322, 34905505, 36404389	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29627567, 30226575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	25236463	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29439669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	22839099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25236463, 29399153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	25236463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	25673160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	22839099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30816466, 31211445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22839099, 28487093, 30226575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	22839099	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	GWASCAT_DG	27182965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22839099, 25236463, 28423514, 28487093, 30816466		★★★★★ ★☆☆☆☆ Found in Text Mining only
NIGHT BLINDNESS, CONGENITAL STATIONARY, TYPE 1H	Night Blindness, Congenital Stationary	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28487093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34577856, 36081320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33437202	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	34970697, 35119046, 37682152	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22839099	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32716971	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30816466, 31211445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33846765	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	40197384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CDCA3 (cell division cycle associated 3)