Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	83416
Gene name	Fc receptor like 5
Gene symbol	FCRL5
Synonyms (NCBI Gene)	BXMAS1CD307CD307eFCRH5IRTA2PRO820
Chromosome	1
Chromosome location	1q23.1
Summary	This gene encodes a member of the immunoglobulin receptor superfamily and the Fc-receptor like family. This gene and several other Fc receptor-like gene members are clustered on the long arm of chromosome 1. The encoded protein is a single-pass type I mem

Show/Hide all (74)

miRTarBase ID	miRNA	Experiments
MIRT994168	hsa-miR-1243	CLIP-seq
MIRT994169	hsa-miR-1290	CLIP-seq
MIRT994170	hsa-miR-2115	CLIP-seq
MIRT994171	hsa-miR-3167	CLIP-seq
MIRT994172	hsa-miR-3202	CLIP-seq
MIRT994173	hsa-miR-3529	CLIP-seq
MIRT994174	hsa-miR-365	CLIP-seq
MIRT994175	hsa-miR-379	CLIP-seq
MIRT994176	hsa-miR-3927	CLIP-seq
MIRT994177	hsa-miR-4330	CLIP-seq
MIRT994178	hsa-miR-4438	CLIP-seq
MIRT994179	hsa-miR-4533	CLIP-seq
MIRT994180	hsa-miR-4633-5p	CLIP-seq
MIRT994181	hsa-miR-4643	CLIP-seq
MIRT994182	hsa-miR-4736	CLIP-seq
MIRT994183	hsa-miR-4766-5p	CLIP-seq
MIRT994184	hsa-miR-491-3p	CLIP-seq
MIRT994185	hsa-miR-548ae	CLIP-seq
MIRT994186	hsa-miR-548aj	CLIP-seq
MIRT994187	hsa-miR-548am	CLIP-seq
MIRT994188	hsa-miR-548q	CLIP-seq
MIRT994189	hsa-miR-548x	CLIP-seq
MIRT994190	hsa-miR-642b	CLIP-seq
MIRT994191	hsa-miR-876-5p	CLIP-seq
MIRT994192	hsa-miR-938	CLIP-seq
MIRT1994820	hsa-miR-1208	CLIP-seq
MIRT1994821	hsa-miR-1915	CLIP-seq
MIRT1994822	hsa-miR-3918	CLIP-seq
MIRT1994823	hsa-miR-4640-5p	CLIP-seq
MIRT1994824	hsa-miR-4685-5p	CLIP-seq
MIRT1994825	hsa-miR-4726-3p	CLIP-seq
MIRT1994826	hsa-miR-4726-5p	CLIP-seq
MIRT1994827	hsa-miR-548n	CLIP-seq
MIRT1994828	hsa-miR-548t	CLIP-seq
MIRT1994829	hsa-miR-595	CLIP-seq
MIRT2228944	hsa-miR-1184	CLIP-seq
MIRT2228945	hsa-miR-1205	CLIP-seq
MIRT2228946	hsa-miR-1245b-5p	CLIP-seq
MIRT2228947	hsa-miR-181a	CLIP-seq
MIRT2228948	hsa-miR-181b	CLIP-seq
MIRT2228949	hsa-miR-181c	CLIP-seq
MIRT2228950	hsa-miR-181d	CLIP-seq
MIRT2228951	hsa-miR-1972	CLIP-seq
MIRT2228952	hsa-miR-3142	CLIP-seq
MIRT2228953	hsa-miR-3156-5p	CLIP-seq
MIRT2228954	hsa-miR-3158-5p	CLIP-seq
MIRT2228955	hsa-miR-421	CLIP-seq
MIRT2228956	hsa-miR-4262	CLIP-seq
MIRT2228957	hsa-miR-4650-5p	CLIP-seq
MIRT2228958	hsa-miR-4709-5p	CLIP-seq
MIRT2228959	hsa-miR-545	CLIP-seq
MIRT2428861	hsa-miR-103a	CLIP-seq
MIRT2428862	hsa-miR-107	CLIP-seq
MIRT2428863	hsa-miR-15a	CLIP-seq
MIRT2428864	hsa-miR-15b	CLIP-seq
MIRT2428865	hsa-miR-16	CLIP-seq
MIRT1994821	hsa-miR-1915	CLIP-seq
MIRT2428866	hsa-miR-195	CLIP-seq
MIRT2428867	hsa-miR-324-5p	CLIP-seq
MIRT1994822	hsa-miR-3918	CLIP-seq
MIRT2428868	hsa-miR-424	CLIP-seq
MIRT2428869	hsa-miR-4310	CLIP-seq
MIRT2428870	hsa-miR-4530	CLIP-seq
MIRT1994823	hsa-miR-4640-5p	CLIP-seq
MIRT1994824	hsa-miR-4685-5p	CLIP-seq
MIRT2428871	hsa-miR-4711-5p	CLIP-seq
MIRT1994825	hsa-miR-4726-3p	CLIP-seq
MIRT1994826	hsa-miR-4726-5p	CLIP-seq
MIRT2428872	hsa-miR-497	CLIP-seq
MIRT2442163	hsa-miR-146b-3p	CLIP-seq
MIRT2442164	hsa-miR-3194-5p	CLIP-seq
MIRT2442165	hsa-miR-4260	CLIP-seq
MIRT2442166	hsa-miR-486-3p	CLIP-seq
MIRT2442167	hsa-miR-922	CLIP-seq

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IBA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IDA	16849395
GO:0005886	Component	Plasma membrane	IEA
GO:0006955	Process	Immune response	IBA
GO:0007166	Process	Cell surface receptor signaling pathway	IBA
GO:0007338	Process	Single fertilization	IEA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009986	Component	Cell surface	IDA	16849395
GO:0009986	Component	Cell surface	IEA
GO:0015026	Function	Coreceptor activity	IDA	30107486
GO:0016020	Component	Membrane	IEA
GO:0042113	Process	B cell activation	IDA	30107486
GO:0042113	Process	B cell activation	IDA	30107486
GO:0042113	Process	B cell activation	TAS	19290921
GO:0043235	Component	Receptor complex	IDA	23382219

MIM	HGNC	e!Ensembl
605877	18508	ENSG00000143297

Q96RD9

Protein name

Fc receptor-like protein 5 (FcR-like protein 5) (FcRL5) (BXMAS1) (Fc receptor homolog 5) (FcRH5) (Immune receptor translocation-associated protein 2) (CD antigen CD307e)

Protein function

Plays an important role in B-cell response to antigen that acts both as a negative or positive coreceptor. Inhibits B-cell receptor (BCR) signaling in the absence of CR2 stimulation but engagement with CR2 and the BCR lead to a superior calcium

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13895	Ig_2	22 → 100	Immunoglobulin domain	Domain
PF13895	Ig_2	104 → 185	Immunoglobulin domain	Domain
PF13895	Ig_2	286 → 373	Immunoglobulin domain	Domain
PF13895	Ig_2	379 → 466	Immunoglobulin domain	Domain
PF13895	Ig_2	472 → 559	Immunoglobulin domain	Domain
PF13895	Ig_2	565 → 652	Immunoglobulin domain	Domain
PF13895	Ig_2	751 → 837	Immunoglobulin domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in marginal zone B-cells, immunoblasts, tonsillar germinal center centrocytes and in the intraepithelial and interfollicular regions of the tonsil. Expressed in many lymphoma cell lines and on hairy cell leukemia cells. Isofo

Sequence

MLLWVILLVLAPVSGQFARTPRPIIFLQPPWTTVFQGERVTLTCKGFRFYSPQKTKWYHR
YLGKEILRETPDNILEVQESGEYRCQAQGSPLSSPVHLDFSSASLILQAPLSVFEGDSVV
LRCRAKAEVTLNNTIYKNDNVLAFLNKRTDFHIPHACLKDNGAYRCTGYKESCCPVSSNT
VKIQVQEPFTRPVLRASSFQPISGNPVTLTCETQLSLERSDVPLRFRFFRDDQTLGLGWS
LSPNFQITAMWSKDSGFYWCKAATMPYSVISDSPRSWIQVQIPASHPVLTLSPEKALNFE
GTKVTLHCETQEDSLRTLYRFYHEGVPLRHKSVRCERGASISFSLTTENSGNYYCTADNG
LGAKPSKAVSLSVTVPVSHPVLNLSSPEDLIFEGAKVTLHCEAQRGSLPILYQFHHEGAA
LERRSANSAGGVAISFSLTAEHSGNYYCTADNGFGPQRSKAVSLSVTVPVSHPVLTLSSA
EALTFEGATVTLHCEVQRGSPQILYQFYHEDMPLWSSSTPSVGRVSFSFSLTEGHSGNYY
CTADNGFGPQRSEVVSLFVTVPVSRPILTLRVPRAQAVVGDLLELHCEAPRGSPPILYWF
YHEDVTLGSSSAPSGGEASFNLSLTAEHSGNYSCEANNGLVAQHSDTISLSVIVPVSRPI
LTFRAPRAQAVVGDLLELHCEALRGSSPILYWFYHEDVTLGKISAPSGGGASFNLSLTTE
HSGIYSCEADNGLEAQRSEMVTLKVAVPVSRPVLTLRAPGTHAAVGDLLELHCEALRGSP
LILYRFFHEDVTLGNRSSPSGGASLNLSLTAEHSGNYSCEADNGLGAQRSETVTLYITGL
TANRSGPFATGVAGGLLSIAGLAAGALLLYCWLSRKAGRKPASDPARSPSDSDSQEPTYH
NVPAWEELQPVYTNANPRGENVVYSEVRIIQEKKKHAVASDPRHLRNKGSPIIYSEVKVA
STPVSGSLFLASSAPHR

Sequence length

977

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATIC DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (29)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	30771554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	19775371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	30771554		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	15671532		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	18704934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	15671532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	16439682	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	18704934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	18704934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35395711	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	34545294	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	32841219	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	20626413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	20626413	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	15671532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	LHGDN	15671532, 16681430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	30718503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	24504816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	36180106	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	15671532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	15671532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11290337, 15671532, 28262555, 28292432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microscopic Polyangiitis	Microscopic polyangiitis	Pubtator	32841219	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	11290337, 28262555, 30550367, 30718503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	17914559, 38035078, 40665393	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	38212320	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	34545294	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	32892204	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

FCRL5 (Fc receptor like 5)