CASP1 (caspase 1)

Gene

• Entrez ID: 834
• Gene name: Caspase 1
• Gene symbol: CASP1
• Synonyms (NCBI Gene): ICE, IL1BC, P45
• Chromosome: 11
• Chromosome location: 11q22.3
• Summary: This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo pro

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT642898	hsa-miR-4712-3p	HITS-CLIP	23824327
MIRT642897	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT642896	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT642895	hsa-miR-412-3p	HITS-CLIP	23824327
MIRT642894	hsa-miR-6754-3p	HITS-CLIP	23824327
MIRT642893	hsa-miR-6837-3p	HITS-CLIP	23824327
MIRT642892	hsa-miR-337-3p	HITS-CLIP	23824327
MIRT642891	hsa-miR-202-5p	HITS-CLIP	23824327
MIRT736405	hsa-miR-491-3p	qRT-PCR, Flow cytometry	33679688
MIRT642898	hsa-miR-4712-3p	HITS-CLIP	23824327
MIRT642897	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT642896	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT642895	hsa-miR-412-3p	HITS-CLIP	23824327
MIRT642894	hsa-miR-6754-3p	HITS-CLIP	23824327
MIRT642893	hsa-miR-6837-3p	HITS-CLIP	23824327
MIRT642892	hsa-miR-337-3p	HITS-CLIP	23824327
MIRT642891	hsa-miR-202-5p	HITS-CLIP	23824327
MIRT756228	hsa-miR-370-3p	Luciferase reporter assay, Western blotting, qRT-PCR	36735415

Transcription factors

Transcription factor	Regulation	Reference
ETS1	Activation	16103071
TP53	Unknown	11278253

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	22464733
GO:0001778	Process	Plasma membrane repair	IDA	20530211
GO:0002221	Process	Pattern recognition receptor signaling pathway	NAS	21918512, 22258606, 29196474, 29247998
GO:0004175	Function	Endopeptidase activity	IDA	24548080
GO:0004197	Function	Cysteine-type endopeptidase activity	IDA	1574116, 2787508, 9334240, 11821383, 15030775, 15326478, 16920334, 22464733, 32109412, 32553275
GO:0004197	Function	Cysteine-type endopeptidase activity	IEA
GO:0004197	Function	Cysteine-type endopeptidase activity	IGI	15882992
GO:0004197	Function	Cysteine-type endopeptidase activity	TAS	10353249
GO:0005515	Function	Protein binding	IPI	11374873, 11390368, 11432859, 11536016, 12888622, 15030775, 15107016, 15383541, 15817483, 16575408, 16785446, 17360653, 17418785, 18329368, 18511561, 24630722, 25416956, 25605870, 27043298, 29892012, 30692621, 31421660, 32296183, 32814053, 34296442, 34589402
GO:0005730	Component	Nucleolus	NAS	28263976
GO:0005737	Component	Cytoplasm	IDA	20197547
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	NAS	19158676, 24803432, 28263976
GO:0005737	Component	Cytoplasm	TAS	22464733
GO:0005829	Component	Cytosol	IDA	20197547
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0005874	Component	Microtubule	NAS	27911804
GO:0005886	Component	Plasma membrane	IEA
GO:0006508	Process	Proteolysis	IDA	12888622, 24548080
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	TAS	7876192
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	7876192
GO:0006954	Process	Inflammatory response	IEA
GO:0007165	Process	Signal transduction	TAS	1373520
GO:0007231	Process	Osmosensory signaling pathway	NAS	22981536
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0008656	Function	Cysteine-type endopeptidase activator activity involved in apoptotic process	TAS	10799503
GO:0009306	Process	Protein secretion	IDA	33883744
GO:0016020	Component	Membrane	IEA
GO:0016540	Process	Protein autoprocessing	IDA	11821383, 32109412
GO:0016787	Function	Hydrolase activity	IEA
GO:0019899	Function	Enzyme binding	IEA
GO:0019900	Function	Kinase binding	IPI	11432859, 11536016, 15383541
GO:0019955	Function	Cytokine binding	IPI	15030775
GO:0030163	Process	Protein catabolic process	IDA	22464733
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IDA	7642516, 11432859, 11821383, 15030775, 15326478, 16037825, 24630722
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IMP	11536016, 22267217
GO:0032731	Process	Positive regulation of interleukin-1 beta production	ISO
GO:0032731	Process	Positive regulation of interleukin-1 beta production	NAS	21918512
GO:0032741	Process	Positive regulation of interleukin-18 production	IDA	15326478
GO:0032991	Component	Protein-containing complex	IDA	16920334
GO:0032991	Component	Protein-containing complex	IEA
GO:0032991	Component	Protein-containing complex	IMP	11536016, 11821383, 15383541
GO:0035655	Process	Interleukin-18-mediated signaling pathway	IDA	14528293
GO:0042742	Process	Defense response to bacterium	ISS
GO:0042802	Function	Identical protein binding	IMP	11432859
GO:0042802	Function	Identical protein binding	IPI	24630722, 27043298
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	22464733
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEP	12761501
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IMP	15383541
GO:0046456	Process	Icosanoid biosynthetic process	NAS	22902502
GO:0046513	Process	Ceramide biosynthetic process	IDA	17303575
GO:0050700	Function	CARD domain binding	IPI	11821383, 16920334
GO:0050727	Process	Regulation of inflammatory response	IBA
GO:0050727	Process	Regulation of inflammatory response	IDA	32109412, 32553275
GO:0050729	Process	Positive regulation of inflammatory response	IDA	32109412, 33883744
GO:0050729	Process	Positive regulation of inflammatory response	IDA	12191486, 15326478, 32109412, 32553275
GO:0050729	Process	Positive regulation of inflammatory response	ISO
GO:0050729	Process	Positive regulation of inflammatory response	NAS	21918512, 24630722, 29255148
GO:0051604	Process	Protein maturation	IDA	21157428, 32109412
GO:0051604	Process	Protein maturation	IDA	9334240, 15326478, 22464733, 32109412, 32553275
GO:0051604	Process	Protein maturation	IEA
GO:0051604	Process	Protein maturation	ISS
GO:0051607	Process	Defense response to virus	NAS	28314590
GO:0061702	Component	Canonical inflammasome complex	IPI	16037825
GO:0061702	Component	Canonical inflammasome complex	NAS	25879286
GO:0070212	Process	Protein poly-ADP-ribosylation	IDA	33186521
GO:0070269	Process	Pyroptotic inflammatory response	IDA	33883744, 36227980
GO:0070269	Process	Pyroptotic inflammatory response	IDA	32109412, 32553275
GO:0070269	Process	Pyroptotic inflammatory response	NAS	19158676, 26121197, 26611636, 29196474
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IDA	1919436, 2950091, 9065432, 9430229, 10854325, 14625308, 20485341
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	22464733
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	22464733
GO:0071222	Process	Cellular response to lipopolysaccharide	IMP	11536016
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0071346	Process	Cellular response to type II interferon	IMP	11536016
GO:0072557	Component	IPAF inflammasome complex	IBA
GO:0072557	Component	IPAF inflammasome complex	ISS
GO:0072558	Component	NLRP1 inflammasome complex	IDA	12191486
GO:0072558	Component	NLRP1 inflammasome complex	IPI	17349957
GO:0072559	Component	NLRP3 inflammasome complex	IBA
GO:0072559	Component	NLRP3 inflammasome complex	IDA	15030775
GO:0072559	Component	NLRP3 inflammasome complex	IPI	29255148
GO:0097169	Component	AIM2 inflammasome complex	IBA
GO:0097169	Component	AIM2 inflammasome complex	IDA	19158676
GO:0097169	Component	AIM2 inflammasome complex	IPI	24630722
GO:0097179	Component	Protease inhibitor complex	IMP	11432859
GO:0140447	Process	Cytokine precursor processing	IGI	15882992
GO:0140448	Process	Signaling receptor ligand precursor processing	IGI	15882992
GO:0140970	Process	AIM2 inflammasome complex assembly	IDA	19158675
GO:0141201	Process	Pyroptotic cell death	IDA	32109412, 33883744, 36227980, 37198476, 38614101
GO:1903265	Process	Positive regulation of tumor necrosis factor-mediated signaling pathway	IMP	16920334

Other IDs

• MIM: 147678
• HGNC: 1499
• e!Ensembl: ENSG00000137752

Protein

• UniProt ID: P29466
• Protein name: Caspase-1 (CASP-1) (EC 3.4.22.36) (Interleukin-1 beta convertase) (IL-1BC) (Interleukin-1 beta-converting enzyme) (ICE) (IL-1 beta-converting enzyme) (p45) [Cleaved into: Caspase-1 subunit p20; Caspase-1 subunit p10]
• Protein function: Thiol protease involved in a variety of inflammatory processes by proteolytically cleaving other proteins, such as the precursors of the inflammatory cytokines interleukin-1 beta (IL1B) and interleukin 18 (IL18) as well as the pyroptosis inducer
• PDB: 1BMQ, 1IBC, 1ICE, 1RWK, 1RWM, 1RWN, 1RWO, 1RWP, 1RWV, 1RWW, 1RWX, 1SC1, 1SC3, 1SC4, 2FQQ, 2H48, 2H4W, 2H4Y, 2H51, 2H54, 2HBQ, 2HBR, 2HBY, 2HBZ, 3D6F, 3D6H, 3D6M, 3E4C, 3NS7, 5FNA, 5MMV, 5MTK, 6BZ9, 6F6R, 6KN0, 6PZP, 6VIE, 7KEU, 8SV1, 8WRA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00619	CARD	3 → 90	Caspase recruitment domain	Domain
  PF00656	Peptidase_C14	163 → 400		Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in larger amounts in spleen and lung. Detected in liver, heart, small intestine, colon, thymus, prostate, skeletal muscle, peripheral blood leukocytes, kidney and testis. No expression in the brain. {ECO:0000269|PubMed:154984
• Sequence:

  MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDS
  VIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDN
  PAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRT
  GAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIR
  EGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVG
  VSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEY
  ACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH

• Sequence length: 404

Pathways

KEGG:

Efferocytosis
Necroptosis
Neutrophil extracellular trap formation
NOD-like receptor signaling pathway
Cytosolic DNA-sensing pathway
C-type lectin receptor signaling pathway
Amyotrophic lateral sclerosis
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Pertussis
Legionellosis
Yersinia infection
Influenza A
Coronavirus disease - COVID-19
Lipid and atherosclerosis

Reactome:

NOD1/2 Signaling Pathway
Interleukin-1 processing
TP53 Regulates Transcription of Caspase Activators and Caspases
The NLRP3 inflammasome
The IPAF inflammasome
Interleukin-37 signaling
Purinergic signaling in leishmaniasis infection

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMYOTROPHIC LATERAL SCLEROSIS 1	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CASP1-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERHOMOCYSTEINEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERSENSITIVITY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOTOR NEURON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STATUS EPILEPTICUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	28456882		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	12894591		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	28052562		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	28823375		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28383547		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	9973322		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	23075869		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	22408263, 28143954		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	27098789		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	23221073, 29454857		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	22824089, 24190435, 29856968, 30148989, 31740004		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	26939933, 34831318, 35172755, 37418137	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	28984607, 30741672, 38599243	Stimulate	★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	28801921		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	29967321		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	Pubtator	35172755	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	10764647, 11682150, 12843244, 31596526, 9861044		★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	CTD_human_DG	11796754		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	BEFREE	12153481		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	CTD_human_DG	11796754		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	BEFREE	15208263		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	CTD_human_DG	11796754		★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	40481763	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	25378535	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	30333099		★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	39512836	Associate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	14729783	Stimulate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30796177		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	22414631, 28521881		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	22414631, 28521881		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	24618883	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	24618883, 25378412, 26941015, 29976759		★☆☆☆☆ Found in Text Mining only
Apraxia, Developmental Verbal	Apraxia	BEFREE	29151018		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	18783480, 25705917, 26059719, 28232172, 28260724, 28992621, 29784903, 31315440		★☆☆☆☆ Found in Text Mining only
Arthralgia	Arthralgia	Pubtator	34248956	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	20177071		★☆☆☆☆ Found in Text Mining only
Arthritis Gouty	Gouty arthritis	Pubtator	32236574	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	28790368	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	19824913, 22275154, 22736089, 23190696, 24762050, 26385789, 33162829, 36532040, 37386795, 37659984	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	BEFREE	31336157		★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	29193391		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	24136334	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	29626160, 30118837, 30888839, 31070765		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	7959739		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	18783480, 25705917, 26059719, 28232172, 28260724, 28992621, 29784903, 31315440		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	20060974	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	39978305	Stimulate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30444763		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	35585786	Stimulate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	37168851, 39481220	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	21969075		★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	29145157		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28453771, 28887852, 29614437		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	34598017	Associate	★☆☆☆☆ Found in Text Mining only
Autoinflammatory disorder	Autoinflammatory Disease	BEFREE	16081838, 17431422, 26003867		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30086544		★☆☆☆☆ Found in Text Mining only
Barber Say syndrome	Barber Say Syndrome	BEFREE	28273882		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	23633568		★☆☆☆☆ Found in Text Mining only
Bernard-Soulier Syndrome	Bernard Soulier Syndrome	BEFREE	28273882		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	23607494		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	30575805	Stimulate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	36359010	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	30596792	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18430458, 29725399		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	32682809	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	15196254	Associate	★☆☆☆☆ Found in Text Mining only
Brooke-Spiegler syndrome	Brooke-Spiegler Syndrome	BEFREE	28273882		★☆☆☆☆ Found in Text Mining only
Burkitt Leukemia	Burkitt`s Lymphoma	BEFREE	22258345		★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	36610524	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19603096	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15809717, 16204022, 18430458		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28990231, 32682809, 40139029, 40302327	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31429707, 36763290	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	18430458, 30365491		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	39969214	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26323562, 32303673	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28430665	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	28954073		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	28954073, 37872948	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	31400606		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	16778130, 20184726	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	25200478, 25705917, 28930551, 29453087		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	29151018	Stimulate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	35008765, 36959587, 38167983	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	38167983	Stimulate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	11803481, 28535504		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	37455655	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	27520275		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28885866, 30979498		★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas Cardiomyopathy	BEFREE	28954073, 29438387		★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas cardiomyopathy	Pubtator	28954073	Associate	★☆☆☆☆ Found in Text Mining only
Chagas Disease	Chagas disease	Pubtator	31057540	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	30039912		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	29886157		★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	BEFREE	26457439		★☆☆☆☆ Found in Text Mining only
Chronic Infantile Neurological, Cutaneous, and Articular Syndrome	Neurological, Cutaneous And Articular Syndrome	BEFREE	15476236, 17431422, 20940146		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	26928596, 28930551		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30072504, 30930781		★☆☆☆☆ Found in Text Mining only
Chronic otitis media	Otitis media	BEFREE	26457439		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	28691886, 30422379		★☆☆☆☆ Found in Text Mining only
Chronic recurrent multifocal osteomyelitis	Recurrent multifocal osteomyelitis	Pubtator	25061439	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	24599568, 29321963, 30236988		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	30276509, 31731189		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	35172755	Associate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	35172755	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	24472848, 30559669, 30823406		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	29556621, 30583612, 36165492, 39596612	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	10097131, 26133168	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30823406		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18799371		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25943872, 35836259	Associate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	29803661		★☆☆☆☆ Found in Text Mining only
Complex Partial Status Epilepticus	Status Epilepticus	CTD_human_DG	18571097		★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	23607494		★☆☆☆☆ Found in Text Mining only
Congenital Thrombotic Thrombocytopenic Purpura	Congenital Thrombotic Thrombocytopenic Purpura	BEFREE	11516238		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	17303764, 25200478		★☆☆☆☆ Found in Text Mining only
Conn Syndrome	Conn Syndrome	BEFREE	31230554		★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	31367484		★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	BEFREE	28885866		★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	35740890	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	16778130, 30939905		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	11527622, 16778130, 28930551	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	16778130, 28930551, 30673706, 30939905		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	16778130, 30673706, 30939905		★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary restenosis	Pubtator	35740890	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	11282552, 29556615	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	14752334, 23171454, 29556615		★☆☆☆☆ Found in Text Mining only
Cryopyrin-Associated Periodic Syndromes	Cryopyrin-Associated Periodic Syndromes	BEFREE	19180500, 20140476, 20179416, 24084736, 24952504, 25596455, 26161132		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	22649552	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	24977480, 31454256		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	31532390, 32118580	Stimulate	★☆☆☆☆ Found in Text Mining only
Cystinosis	Cystinosis	BEFREE	24525029		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	19824913, 27146654, 28805067, 31545916		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	27951472		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	12633148		★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	30552710		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	11226333, 28416811, 29016824, 30177877		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	20179416, 28396236		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	Pubtator	32122970	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	36736455	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	38250727	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	24510054, 24894535, 29957081, 30183461, 30991764		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	27098789		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	24672804, 29633641, 31817997		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	24055273	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	38326276	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	24672804, 29633641, 31817997		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28164132	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	36099092	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18263705, 29151018	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	23086037, 30024959	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28289409		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28935571, 29151018, 30422379, 30939905, 30961396		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	39378104	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	28726778	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	29450537, 29571734		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	36430950	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	22408263, 28143954, 29386196		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	10666665		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	27293319	Associate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	25962072	Stimulate	★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	27339879		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	24510054, 24894535, 29957081, 30183461, 30991764		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	22003197		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	24330827	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	31695408		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	17094974, 36233009	Associate	★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	Pubtator	34248956	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	32219137	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	38166692	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	25626361		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	31803101		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	30123073		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	30123073		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	37522671, 40295580	Associate	★☆☆☆☆ Found in Text Mining only
Esophagitis	Esophagitis	BEFREE	30123073		★☆☆☆☆ Found in Text Mining only
Familial cold urticaria	Cold urticaria	BEFREE	16081838, 31597739		★☆☆☆☆ Found in Text Mining only
Familial cylindromatosis	Familial cylindromatosis	Pubtator	36553511	Associate	★☆☆☆☆ Found in Text Mining only
Familial Mediterranean Fever	Familial mediterranean fever	Pubtator	16785446, 19784369, 26161132, 39684669	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	39350187	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28167322, 30103942, 31585800, 31599445		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28167322, 31301646, 9211568		★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	26710067	Associate	★☆☆☆☆ Found in Text Mining only
Fulminant hepatitis	Fulminant Hepatitis	BEFREE	30825154		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	33907835	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	30138921, 31645367		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	19269008		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	28367892		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingival diseases	Pubtator	28367892	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	15208263		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	25330190	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	15208263, 25330190, 30846550		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28244850, 9409814		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28244850, 30015880, 35216164, 36325335, 36389690, 9409814	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	26160272		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	26160272	Stimulate	★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid receptor deficiency/resistance	Pubtator	25938942	Associate	★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	25977218		★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	22491736	Associate	★☆☆☆☆ Found in Text Mining only
Grand Mal Status Epilepticus	Grand Mal Status Epilepticus	CTD_human_DG	18571097		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	28954073	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	17303764, 25200478		★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	31710248		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	28716155		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	40303498	Associate	★☆☆☆☆ Found in Text Mining only
Hematuria	Hematuria	Pubtator	34118858	Associate	★☆☆☆☆ Found in Text Mining only
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	9840908		★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	25149528	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	35806450	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	35806450, 36376416	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	24130824, 34840527	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12215842		★☆☆☆☆ Found in Text Mining only
HETEROTAXY, VISCERAL, 2, AUTOSOMAL	Heterotaxy, Visceral	BEFREE	25200478		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	11092762, 11765125, 16354923		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	25798846	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	21270263, 26095630, 30657854		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	33396676	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	CTD_human_DG	22647887		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	28193546		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipidemia	Hyperlipidemia	BEFREE	25705917		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	39512836	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30908936		★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	30054450		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	25185259, 29941940	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	39343901	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	11334117, 33968032	Associate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	31465776		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	29250536		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	34823899	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	17593876, 29665808, 30217141, 30254377, 30276509, 30524241, 30560481, 31145977, 31634653		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	10337015, 25943872, 26240347, 9536946	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	20185692, 31787755, 9536946		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	34093533	Stimulate	★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	28396236		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	37047241	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	25284686, 37325631	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	27146654		★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	27146654	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	25943872	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	29393276, 31634653		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	34895131	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	30979498		★☆☆☆☆ Found in Text Mining only
Juvenile Neuronal Ceroid Lipofuscinosis	Neuronal Ceroid Lipofuscinosis	BEFREE	29873075		★☆☆☆☆ Found in Text Mining only
Juvenile polyposis syndrome	Polyposis Syndrome	BEFREE	30168623		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	15326138, 28961278, 30793631		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	CTD_human_DG	22647887		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney disease	Pubtator	24701032, 34118858	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	BEFREE	30425198, 30922667		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Acute	Kidney Failure	BEFREE	29038261		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	23155228		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	19603096	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	25938942, 33999861	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	28052562	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	33999861, 8541550	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	7629564, 8656695, 9322679		★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	BEFREE	29592872		★☆☆☆☆ Found in Text Mining only
Leukoplakia	Leukoplakia	BEFREE	26403071		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	26403071		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28011505, 28990231, 30277836, 30556857		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	24599568, 29321963, 30236988, 9211568		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	35806450	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	31429707, 36376416	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	14614329, 40311306	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	24992143, 28039299, 28396236		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	9120390	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	24992143, 28039299, 28396236		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	24992143, 28039299, 28396236		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	36610524	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	24992143, 28039299, 28396236		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	30596402		★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	29663029		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	19414860, 29663029		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	29663029		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	16428475		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	LHGDN	16428475		★☆☆☆☆ Found in Text Mining only
Majeed syndrome	Majeed syndrome	Pubtator	33314777	Stimulate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	30306457, 31515707		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	8521409		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	24431405, 26689911		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29725399		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	31695408		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	30123073		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	11267979, 19603096		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30365491		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	26403071		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11221855, 12918059, 15274298, 28388569, 30344932		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	25562666		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15809717		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15274298, 20385749, 26403071, 28000894, 28153032, 29653983, 29978708, 30640520, 30943218, 31645367		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	26658898		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12170183		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	19383853, 36068291	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30078841, 30149677, 31442452		★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	38052629	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	11226333, 28416811, 29016824, 30177877		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	24013717, 29065888		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	24013717	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	30614120		★☆☆☆☆ Found in Text Mining only
Mevalonate Kinase Deficiency	Mevalonate kinase deficiency	Pubtator	18684863	Associate	★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	30199767	Associate	★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	23254930		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	34216617	Stimulate	★☆☆☆☆ Found in Text Mining only
Muckle-Wells Syndrome	Muckle-Wells Syndrome	BEFREE	17431422, 19180500, 22512814		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	34193364	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	26146985	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10567499, 11997061, 15471361, 29615953, 29849483, 29895691		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	10567499	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	LHGDN	15471361		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	CTD_human_DG	25458313		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	35648256	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis, Acute Fulminating	Multiple Sclerosis	CTD_human_DG	25458313		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	10567499		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	36619896	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	28743581		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	10497846, 27737891		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	37420006, 8839858	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	30167087, 9529127, 9760148		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	16778130, 17303764, 20184726, 28399648, 29992382		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	16778130, 20184726	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	35558073	Inhibit	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	20635349		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	11226429	Associate	★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	30618088		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10096572, 11221855, 11267979, 12894591, 12918059, 19798049, 19834516, 21118981, 23140466, 24687871, 25109451, 26497552, 26689911, 28397782, 28551814, 28974683, 9516857		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	24992143		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	25626361, 31611307		★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	19834516, 23140466		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10715578, 15208263, 15460444, 19834516, 23940760, 29886343, 9516857, 9861044		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	35172755	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	23254930, 30276509, 30295793		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	24861026, 28163820, 29665983, 30019185		★☆☆☆☆ Found in Text Mining only
Non-Convulsive Status Epilepticus	Nonconvulsive status epilepticus	CTD_human_DG	18571097		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28383547		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	CTD_human_DG	22325453		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	27146654, 28805067, 33677475, 40165317	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	33430857	Associate	★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	29884910		★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	34765084, 35403328	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	30422379		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	28167279		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28000894, 28259906		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	28259906, 40595878	Associate	★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	BEFREE	30676848		★☆☆☆☆ Found in Text Mining only
Otitis Media with Effusion	Otitis media	BEFREE	30676848, 31821259		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11226429		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	29228654		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	11454803, 32682809	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	14669344	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	14669344	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	22415665, 31593700		★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	14669344	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	27339879, 30290273, 30381407		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	31915018	Stimulate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	32006615	Inhibit	★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	28442553		★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	29066283		★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical periodontitis	Pubtator	36359010	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	28691886		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	29184853, 29791256, 31341421, 31739483		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	39978305	Stimulate	★☆☆☆☆ Found in Text Mining only
Petit mal status	Petit Mal Status	CTD_human_DG	18571097		★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	28271611		★☆☆☆☆ Found in Text Mining only
Polyostotic fibrous dysplasia	Polyostotic Fibrous Dysplasia	BEFREE	29783158		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	12633148		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	28271611		★☆☆☆☆ Found in Text Mining only
PROPERDIN DEFICIENCY, X-LINKED	Properdin Deficiency, X-Linked	BEFREE	29783158		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11221855, 15274298, 20402676, 28388569, 30344932		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15274298, 28663562	Associate	★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	29803661		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	26707913, 30393369, 31837587		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	35534521, 35583006, 40243422	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	28814068, 29476075		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	19633559		★☆☆☆☆ Found in Text Mining only
Purpura, Thrombotic Thrombocytopenic	Thrombotic thrombocytopenic purpura	BEFREE	11516238, 9840908		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	11267979, 19603096		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11267979		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	19824913, 23171454, 23687262, 28240593, 29752727, 30875506, 31327667		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	18806920		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	37946206	Associate	★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	32219137, 38166692	Associate	★☆☆☆☆ Found in Text Mining only
Seizures Febrile	Seizures	Pubtator	38218765	Stimulate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	18263805	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	16625199, 16977333, 26158519, 27142195, 29052227, 29176403, 29192367, 29465571, 30216298, 30877875, 31145977, 31432108, 31775794		★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	BEFREE	30185776		★☆☆☆☆ Found in Text Mining only
Sex Differentiation Disorders	Sex Differentiation Disorders	BEFREE	26005048, 29031534, 29281833, 29423011, 29780394, 29853787, 29864926, 31394382, 31528095, 31814872		★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	29611111		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	23906036	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	16428475, 24510054, 29455734, 29957081, 30025384, 30183461		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	28430665, 29653983		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33741902, 35574984	Associate	★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	21052690		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	CTD_human_DG	18571097		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus, Subclinical	Status Epilepticus	CTD_human_DG	18571097		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	23075869, 28167322, 29321963, 29735977		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15809717		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	18946358, 34376808, 34686215	Associate	★☆☆☆☆ Found in Text Mining only
Stomatitis Aphthous	Aphthous stomatitis	Pubtator	21478439	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	35008765, 38167983	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28903766, 29163015		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	21792841, 25739168, 30978354		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	37990304	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	29915579	Stimulate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	21152100, 37681500	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	16907856, 23636052, 30583612		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	30306457		★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	Pubtator	34248956	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	29568968		★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	30941060		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	31230554	Associate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	26710067	Stimulate	★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	30729374		★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	28954073	Associate	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	31871426, 38250727	Stimulate	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	33101286	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	32035094	Associate	★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner Syndrome	BEFREE	9681877		★☆☆☆☆ Found in Text Mining only