Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8324
Gene name	Frizzled class receptor 7
Gene symbol	FZD7
Synonyms (NCBI Gene)	FzE3
Chromosome	2
Chromosome location	2q33.1
Summary	Members of the `frizzled` gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD7 protein contains an N-terminal signal sequence, 10 cysteine residues typical of the cysteine-rich extracellular domain of

138

Show/Hide all (138)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005690	hsa-miR-145-5p	Luciferase reporter assay	20737575
MIRT024428	hsa-miR-215-5p	Microarray	19074876
MIRT026887	hsa-miR-192-5p	Microarray	19074876
MIRT036603	hsa-miR-940	CLASH	23622248
MIRT438813	hsa-miR-1-3p	Luciferase reporter assayqRT-PCRWestern blot	23939491
MIRT438813	hsa-miR-1-3p	Luciferase reporter assayqRT-PCRWestern blot	23939491
MIRT484258	hsa-miR-548m	PAR-CLIP	20371350
MIRT484257	hsa-miR-6755-5p	PAR-CLIP	20371350
MIRT484256	hsa-miR-142-3p	PAR-CLIP	20371350
MIRT484255	hsa-miR-4654	PAR-CLIP	20371350
MIRT484254	hsa-miR-4769-5p	PAR-CLIP	20371350
MIRT484258	hsa-miR-548m	PAR-CLIP	23592263
MIRT484257	hsa-miR-6755-5p	PAR-CLIP	23592263
MIRT484256	hsa-miR-142-3p	PAR-CLIP	23592263
MIRT484255	hsa-miR-4654	PAR-CLIP	23592263
MIRT484254	hsa-miR-4769-5p	PAR-CLIP	23592263
MIRT484258	hsa-miR-548m	PAR-CLIP	23592263
MIRT484257	hsa-miR-6755-5p	PAR-CLIP	23592263
MIRT484256	hsa-miR-142-3p	PAR-CLIP	23592263
MIRT484255	hsa-miR-4654	PAR-CLIP	23592263
MIRT484254	hsa-miR-4769-5p	PAR-CLIP	23592263
MIRT731953	hsa-miR-485-5p	Luciferase reporter assayqRT-PCRWestern blot	28364602
MIRT731953	hsa-miR-485-5p	Luciferase reporter assayqRT-PCRWestern blot	28364602
MIRT732131	hsa-miR-27b-3p	Luciferase reporter assayqRT-PCRWestern blot	26780940
MIRT732131	hsa-miR-27b-3p	Luciferase reporter assayqRT-PCRWestern blot	26780940
MIRT438813	hsa-miR-1-3p	Luciferase reporter assayWestern blot	26497855
MIRT484256	hsa-miR-142-3p	PAR-CLIP	27292025
MIRT484255	hsa-miR-4654	PAR-CLIP	27292025
MIRT484254	hsa-miR-4769-5p	PAR-CLIP	27292025
MIRT484258	hsa-miR-548m	PAR-CLIP	27292025
MIRT484257	hsa-miR-6755-5p	PAR-CLIP	27292025
MIRT735182	hsa-miR-206	Immunohistochemistry (IHC)qRT-PCRIn situ hybridization	32722078
MIRT735915	hsa-miR-1-5p	Luciferase reporter assayWestern blottingqRT-PCR	33215510
MIRT484258	hsa-miR-548m	PAR-CLIP	20371350
MIRT484257	hsa-miR-6755-5p	PAR-CLIP	20371350
MIRT484256	hsa-miR-142-3p	PAR-CLIP	20371350
MIRT484255	hsa-miR-4654	PAR-CLIP	20371350
MIRT484254	hsa-miR-4769-5p	PAR-CLIP	20371350
MIRT484258	hsa-miR-548m	PAR-CLIP	23592263
MIRT484257	hsa-miR-6755-5p	PAR-CLIP	23592263
MIRT484256	hsa-miR-142-3p	PAR-CLIP	23592263
MIRT484255	hsa-miR-4654	PAR-CLIP	23592263
MIRT484254	hsa-miR-4769-5p	PAR-CLIP	23592263
MIRT484258	hsa-miR-548m	PAR-CLIP	23592263
MIRT484257	hsa-miR-6755-5p	PAR-CLIP	23592263
MIRT484256	hsa-miR-142-3p	PAR-CLIP	23592263
MIRT484255	hsa-miR-4654	PAR-CLIP	23592263
MIRT484254	hsa-miR-4769-5p	PAR-CLIP	23592263
MIRT1008550	hsa-miR-1	CLIP-seq
MIRT1008551	hsa-miR-1264	CLIP-seq
MIRT1008552	hsa-miR-2052	CLIP-seq
MIRT1008553	hsa-miR-2276	CLIP-seq
MIRT1008554	hsa-miR-3148	CLIP-seq
MIRT1008555	hsa-miR-3150a-3p	CLIP-seq
MIRT1008556	hsa-miR-3152-5p	CLIP-seq
MIRT1008557	hsa-miR-3175	CLIP-seq
MIRT1008558	hsa-miR-3184	CLIP-seq
MIRT1008559	hsa-miR-423-5p	CLIP-seq
MIRT1008560	hsa-miR-4255	CLIP-seq
MIRT1008561	hsa-miR-4315	CLIP-seq
MIRT1008562	hsa-miR-4443	CLIP-seq
MIRT1008563	hsa-miR-4668-5p	CLIP-seq
MIRT1008564	hsa-miR-4684-3p	CLIP-seq
MIRT1008565	hsa-miR-4696	CLIP-seq
MIRT1008566	hsa-miR-4774-3p	CLIP-seq
MIRT1008567	hsa-miR-491-5p	CLIP-seq
MIRT1008568	hsa-miR-586	CLIP-seq
MIRT1008569	hsa-miR-613	CLIP-seq
MIRT1008570	hsa-miR-939	CLIP-seq
MIRT1998811	hsa-miR-128	CLIP-seq
MIRT1998812	hsa-miR-23a	CLIP-seq
MIRT1998813	hsa-miR-23b	CLIP-seq
MIRT1998814	hsa-miR-23c	CLIP-seq
MIRT1998815	hsa-miR-27a	CLIP-seq
MIRT1998816	hsa-miR-27b	CLIP-seq
MIRT1998817	hsa-miR-3133	CLIP-seq
MIRT1008556	hsa-miR-3152-5p	CLIP-seq
MIRT1998818	hsa-miR-3163	CLIP-seq
MIRT1008557	hsa-miR-3175	CLIP-seq
MIRT1998819	hsa-miR-4698	CLIP-seq
MIRT1008566	hsa-miR-4774-3p	CLIP-seq
MIRT1998820	hsa-miR-600	CLIP-seq
MIRT1008552	hsa-miR-2052	CLIP-seq
MIRT1998812	hsa-miR-23a	CLIP-seq
MIRT1998813	hsa-miR-23b	CLIP-seq
MIRT1998814	hsa-miR-23c	CLIP-seq
MIRT1998817	hsa-miR-3133	CLIP-seq
MIRT2232511	hsa-miR-4511	CLIP-seq
MIRT2232512	hsa-miR-4717-3p	CLIP-seq
MIRT2232513	hsa-miR-513a-3p	CLIP-seq
MIRT2232514	hsa-miR-520d-5p	CLIP-seq
MIRT2232515	hsa-miR-524-5p	CLIP-seq
MIRT2232516	hsa-miR-607	CLIP-seq
MIRT1008551	hsa-miR-1264	CLIP-seq
MIRT2388308	hsa-miR-1324	CLIP-seq
MIRT2388309	hsa-miR-3166	CLIP-seq
MIRT2388310	hsa-miR-4446-3p	CLIP-seq
MIRT2388311	hsa-miR-4675	CLIP-seq
MIRT2388312	hsa-miR-4718	CLIP-seq
MIRT2388313	hsa-miR-4741	CLIP-seq
MIRT2449977	hsa-miR-3065-5p	CLIP-seq
MIRT1008554	hsa-miR-3148	CLIP-seq
MIRT1008563	hsa-miR-4668-5p	CLIP-seq
MIRT1998820	hsa-miR-600	CLIP-seq
MIRT2536169	hsa-miR-1245b-3p	CLIP-seq
MIRT2536170	hsa-miR-1273d	CLIP-seq
MIRT2536171	hsa-miR-1285	CLIP-seq
MIRT2536172	hsa-miR-145	CLIP-seq
MIRT1008552	hsa-miR-2052	CLIP-seq
MIRT2536173	hsa-miR-3185	CLIP-seq
MIRT2536174	hsa-miR-3187-5p	CLIP-seq
MIRT2536175	hsa-miR-328	CLIP-seq
MIRT2536176	hsa-miR-378g	CLIP-seq
MIRT2536177	hsa-miR-3925-3p	CLIP-seq
MIRT2536178	hsa-miR-4308	CLIP-seq
MIRT2536179	hsa-miR-4436b-5p	CLIP-seq
MIRT2536180	hsa-miR-4437	CLIP-seq
MIRT2536181	hsa-miR-4486	CLIP-seq
MIRT2536182	hsa-miR-4495	CLIP-seq
MIRT2536183	hsa-miR-4674	CLIP-seq
MIRT2536184	hsa-miR-4709-3p	CLIP-seq
MIRT2536185	hsa-miR-4725-5p	CLIP-seq
MIRT2536186	hsa-miR-4731-3p	CLIP-seq
MIRT2536187	hsa-miR-4801	CLIP-seq
MIRT2536188	hsa-miR-493	CLIP-seq
MIRT2536189	hsa-miR-504	CLIP-seq
MIRT2536190	hsa-miR-612	CLIP-seq
MIRT2536191	hsa-miR-875-3p	CLIP-seq
MIRT2536169	hsa-miR-1245b-3p	CLIP-seq
MIRT1008552	hsa-miR-2052	CLIP-seq
MIRT2536173	hsa-miR-3185	CLIP-seq
MIRT2681268	hsa-miR-323-3p	CLIP-seq
MIRT2536179	hsa-miR-4436b-5p	CLIP-seq
MIRT2536182	hsa-miR-4495	CLIP-seq
MIRT2536184	hsa-miR-4709-3p	CLIP-seq
MIRT2536186	hsa-miR-4731-3p	CLIP-seq
MIRT2536187	hsa-miR-4801	CLIP-seq
MIRT2536188	hsa-miR-493	CLIP-seq

Show/Hide all (57)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005109	Function	Frizzled binding	IPI	19188438
GO:0005515	Function	Protein binding	IPI	16189514, 18256285, 18313787, 21314951, 26126266, 27386966, 27680706, 28298427, 31515488, 32296183
GO:0005546	Function	Phosphatidylinositol-4,5-bisphosphate binding	IDA	27386966
GO:0005768	Component	Endosome	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	18256285, 27386966
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IMP	18681827
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0010008	Component	Endosome membrane	IEA
GO:0010812	Process	Negative regulation of cell-substrate adhesion	IEA
GO:0010812	Process	Negative regulation of cell-substrate adhesion	IMP	18156211
GO:0014834	Process	Skeletal muscle satellite cell maintenance involved in skeletal muscle regeneration	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9707618
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0017147	Function	Wnt-protein binding	IBA
GO:0017147	Function	Wnt-protein binding	IEA
GO:0017147	Function	Wnt-protein binding	IPI	18313787
GO:0017147	Function	Wnt-protein binding	NAS	24431302
GO:0019827	Process	Stem cell population maintenance	IMP	18681827
GO:0030165	Function	PDZ domain binding	IEA
GO:0030165	Function	PDZ domain binding	IPI	18256285, 19388021
GO:0030182	Process	Neuron differentiation	ISS
GO:0033077	Process	T cell differentiation in thymus	IEA
GO:0034446	Process	Substrate adhesion-dependent cell spreading	IEA
GO:0035567	Process	Non-canonical Wnt signaling pathway	IBA
GO:0035567	Process	Non-canonical Wnt signaling pathway	IEA
GO:0035567	Process	Non-canonical Wnt signaling pathway	IMP	19773752
GO:0042327	Process	Positive regulation of phosphorylation	IDA	18256285
GO:0042666	Process	Negative regulation of ectodermal cell fate specification	IMP	18681827
GO:0042813	Function	Wnt receptor activity	IBA
GO:0042813	Function	Wnt receptor activity	IDA	28733458
GO:0042813	Function	Wnt receptor activity	IEA
GO:0042813	Function	Wnt receptor activity	NAS	24431302
GO:0043410	Process	Positive regulation of MAPK cascade	IMP	19773752
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	18215320
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	19773752
GO:0046330	Process	Positive regulation of JNK cascade	IC	18256285
GO:0048103	Process	Somatic stem cell division	IEA
GO:0055038	Component	Recycling endosome membrane	IDA	27386966
GO:0060054	Process	Positive regulation of epithelial cell proliferation involved in wound healing	IMP	18313787
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0060070	Process	Canonical Wnt signaling pathway	IDA	18215320, 20802536, 28733458
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IMP	18313787, 19773752
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	NAS	24431302
GO:0060231	Process	Mesenchymal to epithelial transition	IMP	17016432
GO:0060828	Process	Regulation of canonical Wnt signaling pathway	IMP	9707618
GO:0071300	Process	Cellular response to retinoic acid	ISS
GO:2000726	Process	Negative regulation of cardiac muscle cell differentiation	IGI	23939491

MIM	HGNC	e!Ensembl
603410	4045	ENSG00000155760

O75084

Protein name

Frizzled-7 (Fz-7) (hFz7) (FzE3)

Protein function

Receptor for Wnt proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation

PDB

4Z33 , 5T44 , 5URV , 5WBS , 6NE2 , 6NE4 , 6O3A , 6O3B , 8QEO , 8YY8 , 9EPO , 9EW2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01392	Fz	49 → 156	Fz domain	Domain
PF01534	Frizzled	244 → 564	Frizzled/Smoothened family membrane region	Family

Tissue specificity

TISSUE SPECIFICITY: High expression in adult skeletal muscle and fetal kidney, followed by fetal lung, adult heart, brain, and placenta. Specifically expressed in squamous cell esophageal carcinomas.

Sequence

MRDPGAAAPLSSLGLCALVLALLGALSAGAGAQPYHGEKGISVPDHGFCQPISIPLCTDI
AYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPC
RSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYP
TAPYLPDLPFTALPPGASDGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRAN
GLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVA
VAHVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLT
WFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDA
LRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTV
PATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIV
GITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV

Sequence length

574

Interactions

View interactions

	KEGG		Reactome
	mTOR signaling pathway Wnt signaling pathway Hippo signaling pathway Signaling pathways regulating pluripotency of stem cells Melanogenesis Cushing syndrome Alzheimer disease Pathways of neurodegeneration - multiple diseases Human papillomavirus infection Pathways in cancer Proteoglycans in cancer Basal cell carcinoma Breast cancer Hepatocellular carcinoma Gastric cancer		PCP/CE pathway Asymmetric localization of PCP proteins WNT5:FZD7-mediated leishmania damping

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE FRACTURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARTIAL EPILEPSY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (86)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenoma	Adenoma	BEFREE	30622113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	9707618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	33934523	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10688908	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	30841855	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	29507296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	29507296	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24897117, 25241036, 30333256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24897117, 27323693, 31436297, 34055036	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29487190	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	9707618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	12368205	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	19874621	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	18313787, 18577996, 25313882, 30154476	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	35854234	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	35850748	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25032869, 30548372		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	25740178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	25740178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	34509526	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15901282, 18592008, 31176574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	15901282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17016432, 17587804, 18592008, 19655379, 19773752, 22161723, 22182510, 28600110, 30191337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17016432, 18592008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18592008, 19655379, 24966994, 28560804	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29067457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	19011014	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	30729701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	36339397	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	37800830	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	11408930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	11408930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	9707618	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	26442469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	35334792	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	27545991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	27409829, 29028093, 31419987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	27409829	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	27409829, 29028093, 31419987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	21205070, 26712519	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	26712519, 27852064, 28481871, 30010402, 31396362, 31419987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28481871	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	15480989, 16098625, 18313787, 18577996, 21055837, 21314951, 25313882, 26498690, 27815069, 29731900, 29747752, 30142536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	29028088	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29559846	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31827644	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	31396362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24897117, 25241036, 30333256, 31157349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	11408930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25032869, 30548372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26703210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11408930, 11798016, 21435459, 29559846, 30622113, 30955216, 31431458, 31733054, 31827644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11798016, 18577996, 22182510, 26498690, 26703210, 27849134, 28669726, 28699810, 29207657, 29411237, 29559846, 30191337, 30333256, 31157349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	25740178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15901282, 18592008, 31176574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	24865425, 26808375	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	26808375, 28364602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	37138862	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	18021006	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	26716419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29752300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11798016, 15480989, 15901282, 16098625, 18313787, 19655379, 21055837, 21472018, 22182510, 26808375, 27852064, 28600110, 29510995, 30096373, 30142536, 30548372, 31396362 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	20187302, 21472018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	37138862	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	31092328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	30548372		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	25032869, 30548372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32362568, 36481629	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33200805, 33934523, 35854234	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33618667	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26703210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	35347223	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28736081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29067457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	29507296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	29507296	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28669726, 29029485		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	29071717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	26442469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11408930, 11798016, 21435459, 29559846, 30622113, 30955216, 31431458, 31733054, 31827644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	21435459, 29559846, 31827644	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31733054	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	21898546, 28544579, 29411237, 30096373, 30333256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	28544579, 30333256	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25976503	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	12057921, 19696931	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

FZD7 (frizzled class receptor 7)