Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8321
Gene name	Frizzled class receptor 1
Gene symbol	FZD1
Synonyms (NCBI Gene)	-
Chromosome	7
Chromosome location	7q21.13
Summary	Members of the `frizzled` gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD1 protein contains a signal peptide, a cysteine-rich domain in the N-terminal extracellular region, 7 transmembrane domains

177

Show/Hide all (177)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005827	hsa-miR-204-5p	Luciferase reporter assayMicroarrayqRT-PCR	21282569
MIRT017459	hsa-miR-335-5p	Microarray	18185580
MIRT024292	hsa-miR-215-5p	Microarray	19074876
MIRT026323	hsa-miR-192-5p	Microarray	19074876
MIRT564130	hsa-miR-1537-3p	PAR-CLIP	20371350
MIRT409150	hsa-miR-224-3p	PAR-CLIP	20371350
MIRT409154	hsa-miR-522-3p	PAR-CLIP	20371350
MIRT409161	hsa-miR-7109-3p	PAR-CLIP	20371350
MIRT409156	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT564129	hsa-miR-105-5p	PAR-CLIP	20371350
MIRT564128	hsa-miR-7853-5p	PAR-CLIP	20371350
MIRT409152	hsa-miR-372-5p	PAR-CLIP	20371350
MIRT409157	hsa-miR-1252-5p	PAR-CLIP	20371350
MIRT409160	hsa-miR-6124	PAR-CLIP	20371350
MIRT564127	hsa-miR-31-5p	PAR-CLIP	20371350
MIRT564130	hsa-miR-1537-3p	PAR-CLIP	20371350
MIRT409150	hsa-miR-224-3p	PAR-CLIP	20371350
MIRT409154	hsa-miR-522-3p	PAR-CLIP	20371350
MIRT409161	hsa-miR-7109-3p	PAR-CLIP	20371350
MIRT409156	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT564129	hsa-miR-105-5p	PAR-CLIP	20371350
MIRT564128	hsa-miR-7853-5p	PAR-CLIP	20371350
MIRT409152	hsa-miR-372-5p	PAR-CLIP	20371350
MIRT409157	hsa-miR-1252-5p	PAR-CLIP	20371350
MIRT409160	hsa-miR-6124	PAR-CLIP	20371350
MIRT564127	hsa-miR-31-5p	PAR-CLIP	20371350
MIRT1007774	hsa-miR-1224-5p	CLIP-seq
MIRT1007775	hsa-miR-1304	CLIP-seq
MIRT1007776	hsa-miR-3117-5p	CLIP-seq
MIRT1007777	hsa-miR-3173-3p	CLIP-seq
MIRT1007778	hsa-miR-3915	CLIP-seq
MIRT1007779	hsa-miR-3928	CLIP-seq
MIRT1007780	hsa-miR-425	CLIP-seq
MIRT1007781	hsa-miR-4689	CLIP-seq
MIRT1007782	hsa-miR-4716-3p	CLIP-seq
MIRT1007783	hsa-miR-4723-5p	CLIP-seq
MIRT1007784	hsa-miR-4728-5p	CLIP-seq
MIRT1007785	hsa-miR-4779	CLIP-seq
MIRT1007786	hsa-miR-765	CLIP-seq
MIRT1549095	hsa-miR-4778-3p	CLIP-seq
MIRT1998558	hsa-miR-1263	CLIP-seq
MIRT1998559	hsa-miR-1275	CLIP-seq
MIRT1998560	hsa-miR-1285	CLIP-seq
MIRT1998561	hsa-miR-1294	CLIP-seq
MIRT1998562	hsa-miR-1297	CLIP-seq
MIRT1998563	hsa-miR-1305	CLIP-seq
MIRT1998564	hsa-miR-132	CLIP-seq
MIRT1998565	hsa-miR-155	CLIP-seq
MIRT1998566	hsa-miR-1910	CLIP-seq
MIRT1998567	hsa-miR-205	CLIP-seq
MIRT1998568	hsa-miR-2053	CLIP-seq
MIRT1998569	hsa-miR-212	CLIP-seq
MIRT1998570	hsa-miR-26a	CLIP-seq
MIRT1998571	hsa-miR-26b	CLIP-seq
MIRT1007776	hsa-miR-3117-5p	CLIP-seq
MIRT1998572	hsa-miR-3119	CLIP-seq
MIRT1998573	hsa-miR-3187-5p	CLIP-seq
MIRT1998574	hsa-miR-3607-3p	CLIP-seq
MIRT1998575	hsa-miR-3616-3p	CLIP-seq
MIRT1998576	hsa-miR-3622b-5p	CLIP-seq
MIRT1998577	hsa-miR-362-5p	CLIP-seq
MIRT1998578	hsa-miR-3684	CLIP-seq
MIRT1998579	hsa-miR-3686	CLIP-seq
MIRT1998580	hsa-miR-3941	CLIP-seq
MIRT1998581	hsa-miR-3945	CLIP-seq
MIRT1998582	hsa-miR-411	CLIP-seq
MIRT1007780	hsa-miR-425	CLIP-seq
MIRT1998583	hsa-miR-4253	CLIP-seq
MIRT1998584	hsa-miR-4260	CLIP-seq
MIRT1998585	hsa-miR-431	CLIP-seq
MIRT1998586	hsa-miR-4316	CLIP-seq
MIRT1998587	hsa-miR-4438	CLIP-seq
MIRT1998588	hsa-miR-4465	CLIP-seq
MIRT1998589	hsa-miR-4477b	CLIP-seq
MIRT1998590	hsa-miR-4525	CLIP-seq
MIRT1998591	hsa-miR-4652-3p	CLIP-seq
MIRT1998592	hsa-miR-466	CLIP-seq
MIRT1998593	hsa-miR-4665-5p	CLIP-seq
MIRT1998594	hsa-miR-4672	CLIP-seq
MIRT1998595	hsa-miR-4699-3p	CLIP-seq
MIRT1998596	hsa-miR-4707-5p	CLIP-seq
MIRT1998597	hsa-miR-4721	CLIP-seq
MIRT1007783	hsa-miR-4723-5p	CLIP-seq
MIRT1998598	hsa-miR-500b	CLIP-seq
MIRT1998599	hsa-miR-501-5p	CLIP-seq
MIRT1998600	hsa-miR-522	CLIP-seq
MIRT1998601	hsa-miR-574-5p	CLIP-seq
MIRT1998602	hsa-miR-583	CLIP-seq
MIRT1998603	hsa-miR-600	CLIP-seq
MIRT1998604	hsa-miR-605	CLIP-seq
MIRT1998605	hsa-miR-612	CLIP-seq
MIRT1998606	hsa-miR-625	CLIP-seq
MIRT1998607	hsa-miR-626	CLIP-seq
MIRT1998608	hsa-miR-638	CLIP-seq
MIRT1998609	hsa-miR-639	CLIP-seq
MIRT1998610	hsa-miR-661	CLIP-seq
MIRT1998611	hsa-miR-759	CLIP-seq
MIRT1998612	hsa-miR-936	CLIP-seq
MIRT2232328	hsa-miR-27a	CLIP-seq
MIRT2232329	hsa-miR-27b	CLIP-seq
MIRT2232330	hsa-miR-412	CLIP-seq
MIRT2232331	hsa-miR-4279	CLIP-seq
MIRT2232332	hsa-miR-4328	CLIP-seq
MIRT2232333	hsa-miR-4691-5p	CLIP-seq
MIRT1549095	hsa-miR-4778-3p	CLIP-seq
MIRT2232334	hsa-miR-513a-5p	CLIP-seq
MIRT1007786	hsa-miR-765	CLIP-seq
MIRT1007783	hsa-miR-4723-5p	CLIP-seq
MIRT2536041	hsa-miR-1236	CLIP-seq
MIRT1998562	hsa-miR-1297	CLIP-seq
MIRT1998563	hsa-miR-1305	CLIP-seq
MIRT1998565	hsa-miR-155	CLIP-seq
MIRT2536042	hsa-miR-204	CLIP-seq
MIRT1998567	hsa-miR-205	CLIP-seq
MIRT1998568	hsa-miR-2053	CLIP-seq
MIRT2536043	hsa-miR-211	CLIP-seq
MIRT1998570	hsa-miR-26a	CLIP-seq
MIRT1998571	hsa-miR-26b	CLIP-seq
MIRT1007776	hsa-miR-3117-5p	CLIP-seq
MIRT2536044	hsa-miR-3161	CLIP-seq
MIRT1998574	hsa-miR-3607-3p	CLIP-seq
MIRT1998577	hsa-miR-362-5p	CLIP-seq
MIRT1998578	hsa-miR-3684	CLIP-seq
MIRT1998579	hsa-miR-3686	CLIP-seq
MIRT2536045	hsa-miR-376c	CLIP-seq
MIRT1998582	hsa-miR-411	CLIP-seq
MIRT1998585	hsa-miR-431	CLIP-seq
MIRT2536046	hsa-miR-4446-5p	CLIP-seq
MIRT1998588	hsa-miR-4465	CLIP-seq
MIRT1998589	hsa-miR-4477b	CLIP-seq
MIRT2536047	hsa-miR-4641	CLIP-seq
MIRT1998591	hsa-miR-4652-3p	CLIP-seq
MIRT2536048	hsa-miR-4755-5p	CLIP-seq
MIRT1998598	hsa-miR-500b	CLIP-seq
MIRT1998599	hsa-miR-501-5p	CLIP-seq
MIRT2536049	hsa-miR-513a-3p	CLIP-seq
MIRT2536050	hsa-miR-561	CLIP-seq
MIRT2536051	hsa-miR-577	CLIP-seq
MIRT1998602	hsa-miR-583	CLIP-seq
MIRT1998604	hsa-miR-605	CLIP-seq
MIRT2536052	hsa-miR-623	CLIP-seq
MIRT1998607	hsa-miR-626	CLIP-seq
MIRT2536053	hsa-miR-642b	CLIP-seq
MIRT1998612	hsa-miR-936	CLIP-seq
MIRT2536041	hsa-miR-1236	CLIP-seq
MIRT1998562	hsa-miR-1297	CLIP-seq
MIRT1998563	hsa-miR-1305	CLIP-seq
MIRT1998565	hsa-miR-155	CLIP-seq
MIRT2536042	hsa-miR-204	CLIP-seq
MIRT1998567	hsa-miR-205	CLIP-seq
MIRT2536043	hsa-miR-211	CLIP-seq
MIRT1998570	hsa-miR-26a	CLIP-seq
MIRT1998571	hsa-miR-26b	CLIP-seq
MIRT1007776	hsa-miR-3117-5p	CLIP-seq
MIRT2536044	hsa-miR-3161	CLIP-seq
MIRT1998574	hsa-miR-3607-3p	CLIP-seq
MIRT1998577	hsa-miR-362-5p	CLIP-seq
MIRT1998578	hsa-miR-3684	CLIP-seq
MIRT1998579	hsa-miR-3686	CLIP-seq
MIRT2536045	hsa-miR-376c	CLIP-seq
MIRT1998582	hsa-miR-411	CLIP-seq
MIRT2536046	hsa-miR-4446-5p	CLIP-seq
MIRT1998588	hsa-miR-4465	CLIP-seq
MIRT2536047	hsa-miR-4641	CLIP-seq
MIRT1998591	hsa-miR-4652-3p	CLIP-seq
MIRT2536048	hsa-miR-4755-5p	CLIP-seq
MIRT1998598	hsa-miR-500b	CLIP-seq
MIRT1998599	hsa-miR-501-5p	CLIP-seq
MIRT2536049	hsa-miR-513a-3p	CLIP-seq
MIRT2536050	hsa-miR-561	CLIP-seq
MIRT2536051	hsa-miR-577	CLIP-seq
MIRT1998602	hsa-miR-583	CLIP-seq
MIRT1998604	hsa-miR-605	CLIP-seq
MIRT2536052	hsa-miR-623	CLIP-seq
MIRT1998607	hsa-miR-626	CLIP-seq
MIRT2536053	hsa-miR-642b	CLIP-seq
MIRT1998612	hsa-miR-936	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
E2F1	Activation	23806799
E2F1	Unknown	20051274

Show/Hide all (59)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003149	Process	Membranous septum morphogenesis	IEA
GO:0003150	Process	Muscular septum morphogenesis	IEA
GO:0003151	Process	Outflow tract morphogenesis	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005102	Function	Signaling receptor binding	IPI	14739301
GO:0005109	Function	Frizzled binding	IPI	19188438
GO:0005515	Function	Protein binding	IPI	19277043, 27680706
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007267	Process	Cell-cell signaling	IDA	10557084
GO:0007267	Process	Cell-cell signaling	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IMP	19421142
GO:0009986	Component	Cell surface	IDA	19643732
GO:0010976	Process	Positive regulation of neuron projection development	ISS
GO:0016020	Component	Membrane	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0017147	Function	Wnt-protein binding	IBA
GO:0017147	Function	Wnt-protein binding	IEA
GO:0017147	Function	Wnt-protein binding	IPI	10557084
GO:0017147	Function	Wnt-protein binding	NAS	23461676
GO:0030165	Function	PDZ domain binding	IEA
GO:0030165	Function	PDZ domain binding	IPI	19388021
GO:0030182	Process	Neuron differentiation	ISS
GO:0030514	Process	Negative regulation of BMP signaling pathway	IEA
GO:0035425	Process	Autocrine signaling	IDA	10557084
GO:0035567	Process	Non-canonical Wnt signaling pathway	IBA
GO:0036520	Process	Astrocyte-dopaminergic neuron signaling	IEA
GO:0042813	Function	Wnt receptor activity	IBA
GO:0042813	Function	Wnt receptor activity	IDA	10557084, 28733458
GO:0042813	Function	Wnt receptor activity	IEA
GO:0042813	Function	Wnt receptor activity	NAS	23461676
GO:0042813	Function	Wnt receptor activity	TAS	24449494
GO:0045446	Process	Endothelial cell differentiation	IEA
GO:0045669	Process	Positive regulation of osteoblast differentiation	IMP	20039315
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	18929644
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	10557084, 14739301
GO:0060022	Process	Hard palate development	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0060070	Process	Canonical Wnt signaling pathway	IDA	10557084, 14739301, 28733458
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IGI	11433302
GO:0060070	Process	Canonical Wnt signaling pathway	IMP	20039315
GO:0060070	Process	Canonical Wnt signaling pathway	NAS	23461676
GO:0060412	Process	Ventricular septum morphogenesis	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0099054	Process	Presynapse assembly	TAS	24449494
GO:1903377	Process	Negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway	IEA
GO:1904948	Process	Midbrain dopaminergic neuron differentiation	NAS	23461676
GO:1905606	Process	Regulation of presynapse assembly	IEA
GO:1990909	Component	Wnt signalosome	IC	10557084
GO:2000739	Process	Regulation of mesenchymal stem cell differentiation	IMP	20039315

MIM	HGNC	e!Ensembl
603408	4038	ENSG00000157240

Q9UP38

Protein name

Frizzled-1 (Fz-1) (hFz1) (FzE1)

Protein function

Receptor for Wnt proteins (PubMed:10557084). Activated by WNT3A, WNT3, WNT1 and to a lesser extent WNT2, but apparently not by WNT4, WNT5A, WNT5B, WNT6, WNT7A or WNT7B (PubMed:10557084). Contradictory results showing activation by WNT7B have bee

PDB

8J9N , 8J9O

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01392	Fz	116 → 223	Fz domain	Domain
PF01534	Frizzled	310 → 637	Frizzled/Smoothened family membrane region	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in adult heart, placenta, lung, kidney, pancreas, prostate, and ovary and in fetal lung and kidney. {ECO:0000269|PubMed:9813155}.

Sequence

MAEEEAPKKSRAAGGGASWELCAGALSARLAEEGSGDAGGRRRPPVDPRRLARQLLLLLW
LLEAPLLLGVRAQAAGQGPGQGPGPGQQPPPPPQQQQSGQQYNGERGISVPDHGYCQPIS
IPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVL
EQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTP
SLLPEFWTSNPQHGGGGHRGGFPGGAGASERGKFSCPRALKVPSYLNYHFLGEKDCGAPC
EPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSG
CYTAVAVAYIAGFLLEDRVVCNDKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWW
VILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVG
LNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVF
SVLYTVPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQAGGGAPPHPPMSPDF
TVFMIKYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNSKQGETTV

Sequence length

647

Interactions

View interactions

	KEGG		Reactome
	mTOR signaling pathway Wnt signaling pathway Hippo signaling pathway Signaling pathways regulating pluripotency of stem cells Melanogenesis Cushing syndrome Alzheimer disease Pathways of neurodegeneration - multiple diseases Human papillomavirus infection Pathways in cancer Proteoglycans in cancer Basal cell carcinoma Breast cancer Hepatocellular carcinoma Gastric cancer		PCP/CE pathway Asymmetric localization of PCP proteins Disassembly of the destruction complex and recruitment of AXIN to the membrane

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
DENTAL CARIES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (80)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenoma	Adenoma	BEFREE	30622113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	29533772		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28921449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	30679601	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brachydactyly	Brachydactyly	BEFREE	30719180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brachydactyly	Brachydactyly	Pubtator	30719180	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	29954850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15492823, 22484497, 25209439, 27859262, 28215225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35660418	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28921449	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23485556	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	27643554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	28921449	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34781823	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	29160422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	30719180	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	25274627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	29021137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30555158, 30689807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23442549, 36293473	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30854133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28678406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	21937024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	30733609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Exudative Vitreoretinopathy	Exudative Vitreoretinopathy	BEFREE	15981244, 21151595, 21177847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	18306168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	36755291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26502731	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	24386373	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Primary	Hyperparathyroidism	BEFREE	22576020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	29160422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	29160422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	17496152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	18478089	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kashin-Beck Disease	Kashin-Beck Disease	BEFREE	30719180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29482174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30804458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15492823, 22484497, 25209439, 27859262, 28215225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27643554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28895566, 30051493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30622113, 31431458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17545618, 19956716, 22182510, 22606268, 25313882, 27815069, 31375149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25274627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	21850537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	26808375	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	21937024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	BEFREE	28111184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29423029		★★★★★ ★☆☆☆☆ Found in Text Mining only
NAIL DISORDER, NONSYNDROMIC CONGENITAL, 9	Nail Diseases	BEFREE	22211385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nail dysplasia	Nail dysplasia	BEFREE	22211385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	28059551	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18306168, 27373314, 30854133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	21472018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	19421142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	27009842	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	30679601	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15705594, 27643554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	30719180	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteonecrosis	Osteonecrosis	Pubtator	30808872	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	15087387, 17318900, 25197350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	25197350	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	19148501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33618667	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	BEFREE	30854133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	18306168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Adenoma	Parathyroid Adenoma	BEFREE	22576020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	33228780	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28895566, 30051493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	21151595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy of prematurity	Pubtator	21151595	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	31735061		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	34118639	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Systemic	Systemic sclerosis	Pubtator	37587067	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Smith-Lemli-Opitz Syndrome	Smith-Lemli-Opitz Syndrome	BEFREE	26998835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30622113, 31431458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31733054, 31736281	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	18306168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	21898546, 27859262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	17939044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Williams Syndrome	Williams Syndrome	BEFREE	9147651		★★★★★ ★☆☆☆☆ Found in Text Mining only

FZD1 (frizzled class receptor 1)