Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	832
Gene name	Capping actin protein of muscle Z-line subunit beta
Gene symbol	CAPZB
Synonyms (NCBI Gene)	CAPBCAPPBCAPZ
Chromosome	1
Chromosome location	1p36.13
Summary	This gene encodes the beta subunit of the barbed-end actin binding protein, which belongs to the F-actin capping protein family. The capping protein is a heterodimeric actin capping protein that blocks actin filament assembly and disassembly at the fast g

222

Show/Hide all (222)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020263	hsa-miR-130b-3p	Sequencing	20371350
MIRT025479	hsa-miR-34a-5p	Proteomics	21566225
MIRT042833	hsa-miR-324-3p	CLASH	23622248
MIRT041682	hsa-miR-484	CLASH	23622248
MIRT035771	hsa-miR-1915-5p	CLASH	23622248
MIRT052892	hsa-miR-3934-5p	CLASH	23622248
MIRT688820	hsa-miR-147b	HITS-CLIP	23313552
MIRT688819	hsa-miR-652-3p	HITS-CLIP	23313552
MIRT688818	hsa-miR-4306	HITS-CLIP	23313552
MIRT688817	hsa-miR-4644	HITS-CLIP	23313552
MIRT688816	hsa-miR-185-5p	HITS-CLIP	23313552
MIRT688815	hsa-miR-6760-5p	HITS-CLIP	23313552
MIRT688814	hsa-miR-1322	HITS-CLIP	23313552
MIRT688813	hsa-miR-211-3p	HITS-CLIP	23313552
MIRT688812	hsa-miR-4270	HITS-CLIP	23313552
MIRT688811	hsa-miR-4441	HITS-CLIP	23313552
MIRT688810	hsa-miR-6754-5p	HITS-CLIP	23313552
MIRT688809	hsa-miR-1266-5p	HITS-CLIP	23313552
MIRT688808	hsa-miR-4518	HITS-CLIP	23313552
MIRT688807	hsa-miR-1273f	HITS-CLIP	23313552
MIRT688806	hsa-miR-6731-5p	HITS-CLIP	23313552
MIRT688805	hsa-miR-8085	HITS-CLIP	23313552
MIRT659853	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT659852	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT659851	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT659850	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT659849	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT659848	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT659847	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT659846	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT659845	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT659844	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT659843	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT659842	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT659841	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT659840	hsa-miR-3689c	HITS-CLIP	23824327
MIRT659839	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT659838	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT659837	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT494361	hsa-miR-483-5p	PAR-CLIP	23592263
MIRT494360	hsa-miR-7-5p	PAR-CLIP	23592263
MIRT494359	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT494358	hsa-miR-1538	PAR-CLIP	23592263
MIRT494357	hsa-miR-4745-3p	PAR-CLIP	23592263
MIRT494356	hsa-miR-328-5p	PAR-CLIP	23592263
MIRT494355	hsa-miR-6885-5p	PAR-CLIP	23592263
MIRT441005	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT441005	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT688820	hsa-miR-147b	HITS-CLIP	23313552
MIRT688819	hsa-miR-652-3p	HITS-CLIP	23313552
MIRT688818	hsa-miR-4306	HITS-CLIP	23313552
MIRT688817	hsa-miR-4644	HITS-CLIP	23313552
MIRT688816	hsa-miR-185-5p	HITS-CLIP	23313552
MIRT688815	hsa-miR-6760-5p	HITS-CLIP	23313552
MIRT688814	hsa-miR-1322	HITS-CLIP	23313552
MIRT688813	hsa-miR-211-3p	HITS-CLIP	23313552
MIRT688812	hsa-miR-4270	HITS-CLIP	23313552
MIRT688811	hsa-miR-4441	HITS-CLIP	23313552
MIRT688810	hsa-miR-6754-5p	HITS-CLIP	23313552
MIRT688809	hsa-miR-1266-5p	HITS-CLIP	23313552
MIRT688808	hsa-miR-4518	HITS-CLIP	23313552
MIRT688807	hsa-miR-1273f	HITS-CLIP	23313552
MIRT688806	hsa-miR-6731-5p	HITS-CLIP	23313552
MIRT688805	hsa-miR-8085	HITS-CLIP	23313552
MIRT659853	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT659852	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT659851	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT659850	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT659849	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT659848	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT659847	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT659846	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT659845	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT659844	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT659843	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT659842	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT659841	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT659840	hsa-miR-3689c	HITS-CLIP	23824327
MIRT659839	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT659838	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT659837	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT494361	hsa-miR-483-5p	PAR-CLIP	23592263
MIRT494360	hsa-miR-7-5p	PAR-CLIP	23592263
MIRT494359	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT494358	hsa-miR-1538	PAR-CLIP	23592263
MIRT494357	hsa-miR-4745-3p	PAR-CLIP	23592263
MIRT494356	hsa-miR-328-5p	PAR-CLIP	23592263
MIRT494355	hsa-miR-6885-5p	PAR-CLIP	23592263
MIRT862716	hsa-miR-1231	CLIP-seq
MIRT862717	hsa-miR-1290	CLIP-seq
MIRT862718	hsa-miR-129-5p	CLIP-seq
MIRT862719	hsa-miR-1301	CLIP-seq
MIRT862720	hsa-miR-1321	CLIP-seq
MIRT862721	hsa-miR-1324	CLIP-seq
MIRT862722	hsa-miR-140-3p	CLIP-seq
MIRT862723	hsa-miR-187	CLIP-seq
MIRT862724	hsa-miR-298	CLIP-seq
MIRT862725	hsa-miR-3155	CLIP-seq
MIRT862726	hsa-miR-3155b	CLIP-seq
MIRT862727	hsa-miR-3163	CLIP-seq
MIRT862728	hsa-miR-3166	CLIP-seq
MIRT862729	hsa-miR-3167	CLIP-seq
MIRT862730	hsa-miR-3177-3p	CLIP-seq
MIRT862731	hsa-miR-329	CLIP-seq
MIRT862732	hsa-miR-362-3p	CLIP-seq
MIRT862733	hsa-miR-3661	CLIP-seq
MIRT862734	hsa-miR-3681	CLIP-seq
MIRT862735	hsa-miR-3688-5p	CLIP-seq
MIRT862736	hsa-miR-377	CLIP-seq
MIRT862737	hsa-miR-4263	CLIP-seq
MIRT862738	hsa-miR-4282	CLIP-seq
MIRT862739	hsa-miR-4475	CLIP-seq
MIRT862740	hsa-miR-4501	CLIP-seq
MIRT862741	hsa-miR-4633-5p	CLIP-seq
MIRT862742	hsa-miR-4660	CLIP-seq
MIRT862743	hsa-miR-4690-5p	CLIP-seq
MIRT862744	hsa-miR-4694-3p	CLIP-seq
MIRT862745	hsa-miR-4739	CLIP-seq
MIRT862746	hsa-miR-4756-5p	CLIP-seq
MIRT862747	hsa-miR-4779	CLIP-seq
MIRT862748	hsa-miR-491-3p	CLIP-seq
MIRT862749	hsa-miR-5047	CLIP-seq
MIRT862750	hsa-miR-522	CLIP-seq
MIRT862751	hsa-miR-532-5p	CLIP-seq
MIRT862752	hsa-miR-542-5p	CLIP-seq
MIRT862753	hsa-miR-548ad	CLIP-seq
MIRT862754	hsa-miR-576-5p	CLIP-seq
MIRT862755	hsa-miR-631	CLIP-seq
MIRT862756	hsa-miR-644	CLIP-seq
MIRT862757	hsa-miR-652	CLIP-seq
MIRT862758	hsa-miR-765	CLIP-seq
MIRT862759	hsa-miR-876-5p	CLIP-seq
MIRT862740	hsa-miR-4501	CLIP-seq
MIRT2193464	hsa-miR-1266	CLIP-seq
MIRT862719	hsa-miR-1301	CLIP-seq
MIRT2193465	hsa-miR-185	CLIP-seq
MIRT862724	hsa-miR-298	CLIP-seq
MIRT862725	hsa-miR-3155	CLIP-seq
MIRT862726	hsa-miR-3155b	CLIP-seq
MIRT2193466	hsa-miR-3664-3p	CLIP-seq
MIRT862735	hsa-miR-3688-5p	CLIP-seq
MIRT862740	hsa-miR-4501	CLIP-seq
MIRT862742	hsa-miR-4660	CLIP-seq
MIRT862743	hsa-miR-4690-5p	CLIP-seq
MIRT2193467	hsa-miR-4743	CLIP-seq
MIRT862747	hsa-miR-4779	CLIP-seq
MIRT862749	hsa-miR-5047	CLIP-seq
MIRT862756	hsa-miR-644	CLIP-seq
MIRT862757	hsa-miR-652	CLIP-seq
MIRT862758	hsa-miR-765	CLIP-seq
MIRT2385535	hsa-miR-361-3p	CLIP-seq
MIRT862718	hsa-miR-129-5p	CLIP-seq
MIRT862722	hsa-miR-140-3p	CLIP-seq
MIRT2427031	hsa-miR-145	CLIP-seq
MIRT862727	hsa-miR-3163	CLIP-seq
MIRT2427032	hsa-miR-3180-5p	CLIP-seq
MIRT862731	hsa-miR-329	CLIP-seq
MIRT862732	hsa-miR-362-3p	CLIP-seq
MIRT862736	hsa-miR-377	CLIP-seq
MIRT862738	hsa-miR-4282	CLIP-seq
MIRT2427033	hsa-miR-4328	CLIP-seq
MIRT2427034	hsa-miR-4659a-3p	CLIP-seq
MIRT2427035	hsa-miR-4659b-3p	CLIP-seq
MIRT2427036	hsa-miR-4753-3p	CLIP-seq
MIRT2427037	hsa-miR-4768-5p	CLIP-seq
MIRT2427038	hsa-miR-942	CLIP-seq
MIRT2193464	hsa-miR-1266	CLIP-seq
MIRT862719	hsa-miR-1301	CLIP-seq
MIRT2193465	hsa-miR-185	CLIP-seq
MIRT862725	hsa-miR-3155	CLIP-seq
MIRT862726	hsa-miR-3155b	CLIP-seq
MIRT862731	hsa-miR-329	CLIP-seq
MIRT862732	hsa-miR-362-3p	CLIP-seq
MIRT862733	hsa-miR-3661	CLIP-seq
MIRT2193466	hsa-miR-3664-3p	CLIP-seq
MIRT862736	hsa-miR-377	CLIP-seq
MIRT862737	hsa-miR-4263	CLIP-seq
MIRT862739	hsa-miR-4475	CLIP-seq
MIRT862740	hsa-miR-4501	CLIP-seq
MIRT2427034	hsa-miR-4659a-3p	CLIP-seq
MIRT2427035	hsa-miR-4659b-3p	CLIP-seq
MIRT862742	hsa-miR-4660	CLIP-seq
MIRT862743	hsa-miR-4690-5p	CLIP-seq
MIRT2427036	hsa-miR-4753-3p	CLIP-seq
MIRT2427037	hsa-miR-4768-5p	CLIP-seq
MIRT862747	hsa-miR-4779	CLIP-seq
MIRT862749	hsa-miR-5047	CLIP-seq
MIRT862752	hsa-miR-542-5p	CLIP-seq
MIRT862753	hsa-miR-548ad	CLIP-seq
MIRT862754	hsa-miR-576-5p	CLIP-seq
MIRT862755	hsa-miR-631	CLIP-seq
MIRT862757	hsa-miR-652	CLIP-seq
MIRT862758	hsa-miR-765	CLIP-seq
MIRT2427038	hsa-miR-942	CLIP-seq
MIRT2193464	hsa-miR-1266	CLIP-seq
MIRT862719	hsa-miR-1301	CLIP-seq
MIRT2193465	hsa-miR-185	CLIP-seq
MIRT862725	hsa-miR-3155	CLIP-seq
MIRT862726	hsa-miR-3155b	CLIP-seq
MIRT862731	hsa-miR-329	CLIP-seq
MIRT862732	hsa-miR-362-3p	CLIP-seq
MIRT862733	hsa-miR-3661	CLIP-seq
MIRT2193466	hsa-miR-3664-3p	CLIP-seq
MIRT862736	hsa-miR-377	CLIP-seq
MIRT862737	hsa-miR-4263	CLIP-seq
MIRT862739	hsa-miR-4475	CLIP-seq
MIRT862740	hsa-miR-4501	CLIP-seq
MIRT2427034	hsa-miR-4659a-3p	CLIP-seq
MIRT2427035	hsa-miR-4659b-3p	CLIP-seq
MIRT862742	hsa-miR-4660	CLIP-seq
MIRT862743	hsa-miR-4690-5p	CLIP-seq
MIRT2427036	hsa-miR-4753-3p	CLIP-seq
MIRT2427037	hsa-miR-4768-5p	CLIP-seq
MIRT862747	hsa-miR-4779	CLIP-seq
MIRT862749	hsa-miR-5047	CLIP-seq
MIRT862752	hsa-miR-542-5p	CLIP-seq
MIRT862753	hsa-miR-548ad	CLIP-seq
MIRT862754	hsa-miR-576-5p	CLIP-seq
MIRT862755	hsa-miR-631	CLIP-seq
MIRT862757	hsa-miR-652	CLIP-seq
MIRT862758	hsa-miR-765	CLIP-seq
MIRT2427038	hsa-miR-942	CLIP-seq

Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003779	Function	Actin binding	IDA	28493397
GO:0003779	Function	Actin binding	IEA
GO:0003779	Function	Actin binding	TAS	7665558
GO:0005515	Function	Protein binding	IPI	26618866, 28493397, 29924966, 30021884, 30361697, 33961781, 35156780, 35271311, 36012204
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005856	Component	Cytoskeleton	TAS	16130169
GO:0005903	Component	Brush border	IEA
GO:0007010	Process	Cytoskeleton organization	IMP	21834987
GO:0008154	Process	Actin polymerization or depolymerization	IEA
GO:0008290	Component	F-actin capping protein complex	IEA
GO:0008290	Component	F-actin capping protein complex	TAS	7665558
GO:0014069	Component	Postsynaptic density	IEA
GO:0015629	Component	Actin cytoskeleton	TAS	7665558
GO:0016020	Component	Membrane	IEA
GO:0022604	Process	Regulation of cell morphogenesis	IMP	21834987
GO:0030017	Component	Sarcomere	IEA
GO:0030027	Component	Lamellipodium	IEA
GO:0030030	Process	Cell projection organization	IEA
GO:0030032	Process	Lamellipodium assembly	IEA
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030863	Component	Cortical cytoskeleton	IEA
GO:0032279	Component	Asymmetric synapse	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0051016	Process	Barbed-end actin filament capping	IEA
GO:0051693	Process	Actin filament capping	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 20458337, 23533145
GO:0071203	Component	WASH complex	IDA	19922875
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098686	Component	Hippocampal mossy fiber to CA3 synapse	IEA
GO:0120212	Component	Sperm head-tail coupling apparatus	IEA

MIM	HGNC	e!Ensembl
601572	1491	ENSG00000077549

P47756

Protein name

F-actin-capping protein subunit beta (CapZ beta)

Protein function

F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these pr

PDB

8F8Q

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01115	F_actin_cap_B	6 → 240	F-actin capping protein, beta subunit	Family

Sequence

MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYL
LCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVY
LWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTN
KSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIV
NGLRSIDAIPDNQKFKQLQRELSQVLTQRQIYIQPDN

Sequence length

277

Interactions

View interactions

	KEGG		Reactome
	Endocytosis Motor proteins Cytoskeleton in muscle cells		MHC class II antigen presentation HSP90 chaperone cycle for steroid hormone receptors (SHR) COPI-mediated anterograde transport COPI-independent Golgi-to-ER retrograde traffic Factors involved in megakaryocyte development and platelet production

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (23)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Coronary Syndrome	Coronary Syndrome	CTD_human_DG	21751358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	22493691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	22493691	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	31223615	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	11536309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	16316942		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	39209986	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	22493691		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypothyroidism	Hypothyroidism	Pubtator	22493691	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	11536309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11536309, 11673416, 14735201, 14749351, 16507112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26965049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate cancer familial	Prostate cancer	Pubtator	10677314	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11536309, 11673416, 14735201, 14749351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	16507112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	34004362	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	26965049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma, Epithelioid	Sarcoma	BEFREE	26965049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	30485936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	30485936	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only

CAPZB (capping actin protein of muscle Z-line subunit beta)