CDC7 (cell division cycle 7)

Gene

• Entrez ID: 8317
• Gene name: Cell division cycle 7
• Gene symbol: CDC7
• Synonyms (NCBI Gene): CDC7L1, HsCDC7, Hsk1, huCDC7
• Chromosome: 1
• Chromosome location: 1p22.1
• Summary: This gene encodes a cell division cycle protein with kinase activity that is critical for the G1/S transition. The yeast homolog is also essential for initiation of DNA replication as cell division occurs. Overexpression of this gene product may be associ

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004845	hsa-miR-192-5p	Luciferase reporter assay, qRT-PCR, Western blot	19074876
MIRT024755	hsa-miR-215-5p	Microarray	19074876
MIRT004845	hsa-miR-192-5p	Reporter assay;Western blot;Microarray;Other	19074876
MIRT027255	hsa-miR-101-3p	Sequencing	20371350
MIRT052381	hsa-let-7a-5p	CLASH	23622248
MIRT039691	hsa-miR-615-3p	CLASH	23622248
MIRT438098	hsa-miR-29a-3p	Luciferase reporter assay	23877787
MIRT438098	hsa-miR-29a-3p	Luciferase reporter assay	23877787
MIRT438098	hsa-miR-29a-3p	Luciferase reporter assay	23877787
MIRT438098	hsa-miR-29a-3p	Luciferase reporter assay	23877787
MIRT438098	hsa-miR-29a-3p	Luciferase reporter assay	23877787
MIRT438098	hsa-miR-29a-3p	Luciferase reporter assay	23877787
MIRT438098	hsa-miR-29a-3p	Luciferase reporter assay	23877787
MIRT438098	hsa-miR-29a-3p	Luciferase reporter assay	23877787
MIRT292166	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT292169	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT292167	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT292168	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT292170	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT878600	hsa-miR-151-5p	CLIP-seq
MIRT878601	hsa-miR-151b	CLIP-seq
MIRT878602	hsa-miR-196a	CLIP-seq
MIRT878603	hsa-miR-196b	CLIP-seq
MIRT878604	hsa-miR-29a	CLIP-seq
MIRT878605	hsa-miR-29b	CLIP-seq
MIRT878606	hsa-miR-29c	CLIP-seq
MIRT878607	hsa-miR-3065-3p	CLIP-seq
MIRT878608	hsa-miR-3150b-3p	CLIP-seq
MIRT878609	hsa-miR-331-5p	CLIP-seq
MIRT878610	hsa-miR-380	CLIP-seq
MIRT878611	hsa-miR-3919	CLIP-seq
MIRT878612	hsa-miR-3927	CLIP-seq
MIRT878613	hsa-miR-4307	CLIP-seq
MIRT878614	hsa-miR-4688	CLIP-seq
MIRT878615	hsa-miR-4784	CLIP-seq
MIRT878616	hsa-miR-486-3p	CLIP-seq
MIRT878617	hsa-miR-767-5p	CLIP-seq
MIRT878600	hsa-miR-151-5p	CLIP-seq
MIRT878601	hsa-miR-151b	CLIP-seq
MIRT878602	hsa-miR-196a	CLIP-seq
MIRT878603	hsa-miR-196b	CLIP-seq
MIRT878618	hsa-miR-223	CLIP-seq
MIRT878608	hsa-miR-3150b-3p	CLIP-seq
MIRT878619	hsa-miR-3163	CLIP-seq
MIRT878609	hsa-miR-331-5p	CLIP-seq
MIRT878620	hsa-miR-3924	CLIP-seq
MIRT878612	hsa-miR-3927	CLIP-seq
MIRT878621	hsa-miR-4276	CLIP-seq
MIRT878613	hsa-miR-4307	CLIP-seq
MIRT878622	hsa-miR-4697-3p	CLIP-seq
MIRT878615	hsa-miR-4784	CLIP-seq
MIRT878623	hsa-miR-4795-3p	CLIP-seq
MIRT878624	hsa-miR-488	CLIP-seq
MIRT878625	hsa-miR-548ag	CLIP-seq
MIRT878626	hsa-miR-548ai	CLIP-seq
MIRT878627	hsa-miR-548m	CLIP-seq
MIRT1960468	hsa-miR-2053	CLIP-seq
MIRT878604	hsa-miR-29a	CLIP-seq
MIRT878605	hsa-miR-29b	CLIP-seq
MIRT878606	hsa-miR-29c	CLIP-seq
MIRT878607	hsa-miR-3065-3p	CLIP-seq
MIRT1960469	hsa-miR-4775	CLIP-seq
MIRT1960470	hsa-miR-569	CLIP-seq
MIRT1960471	hsa-miR-590-3p	CLIP-seq
MIRT878600	hsa-miR-151-5p	CLIP-seq
MIRT878601	hsa-miR-151b	CLIP-seq
MIRT878604	hsa-miR-29a	CLIP-seq
MIRT878605	hsa-miR-29b	CLIP-seq
MIRT878606	hsa-miR-29c	CLIP-seq
MIRT878607	hsa-miR-3065-3p	CLIP-seq
MIRT878608	hsa-miR-3150b-3p	CLIP-seq
MIRT878610	hsa-miR-380	CLIP-seq
MIRT878615	hsa-miR-4784	CLIP-seq
MIRT878617	hsa-miR-767-5p	CLIP-seq
MIRT2500477	hsa-miR-192	CLIP-seq
MIRT2500478	hsa-miR-215	CLIP-seq
MIRT878618	hsa-miR-223	CLIP-seq
MIRT2500479	hsa-miR-3646	CLIP-seq
MIRT2500480	hsa-miR-3662	CLIP-seq
MIRT2500481	hsa-miR-3686	CLIP-seq
MIRT2500482	hsa-miR-371b-5p	CLIP-seq
MIRT2500483	hsa-miR-4268	CLIP-seq
MIRT2500484	hsa-miR-4448	CLIP-seq
MIRT2500485	hsa-miR-4652-3p	CLIP-seq
MIRT2500486	hsa-miR-4666-5p	CLIP-seq
MIRT878622	hsa-miR-4697-3p	CLIP-seq
MIRT2500487	hsa-miR-4698	CLIP-seq
MIRT2500488	hsa-miR-4742-3p	CLIP-seq
MIRT2500489	hsa-miR-495	CLIP-seq
MIRT2500490	hsa-miR-548a-3p	CLIP-seq
MIRT2500491	hsa-miR-548e	CLIP-seq
MIRT2500492	hsa-miR-548f	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	TAS	9405610
GO:0000166	Function	Nucleotide binding	IEA
GO:0000727	Process	Double-strand break repair via break-induced replication	IBA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	IMP	12065429, 15668232
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	12065429, 15668232, 16899510, 22540012, 23064647, 24299456, 28514442, 31515488, 32296183, 32707033, 32814053, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	9250678
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	9250678
GO:0007165	Process	Signal transduction	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	17102137
GO:0010571	Process	Positive regulation of nuclear cell cycle DNA replication	IMP	15668232
GO:0010971	Process	Positive regulation of G2/M transition of mitotic cell cycle	IMP	15668232
GO:0016301	Function	Kinase activity	IDA	9250678
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0044770	Process	Cell cycle phase transition	IMP	17102137
GO:0045171	Component	Intercellular bridge	IDA
GO:0046872	Function	Metal ion binding	IEA
GO:0051301	Process	Cell division	IEA
GO:0072686	Component	Mitotic spindle	IDA
GO:0106310	Function	Protein serine kinase activity	IEA

Other IDs

• MIM: 603311
• HGNC: 1745
• e!Ensembl: ENSG00000097046

Protein

• UniProt ID: O00311
• Protein name: Cell division cycle 7-related protein kinase (CDC7-related kinase) (HsCdc7) (huCdc7) (EC 2.7.11.1)
• Protein function: Kinase involved in initiation of DNA replication. Phosphorylates critical substrates that regulate the G1/S phase transition and initiation of DNA replication, such as MCM proteins and CLASPIN. {ECO:0000269|PubMed:12065429, ECO:0000269|PubMed:27
• PDB: 4F99, 4F9A, 4F9B, 4F9C, 5UWQ, 5UWR, 6YA6, 6YA7, 6YA8
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	58 → 221	Protein kinase domain	Domain
  PF00069	Pkinase	357 → 482	Protein kinase domain	Domain

• Sequence:

  MEASLGIQMDEPMAFSPQRDRFQAEGSLKKNEQNFKLAGVKKDIEKLYEAVPQLSNVFKI
  EDKIGEGTFSSVYLATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGV
  KYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREYMLNLFKALKRIHQFGIVHRDVKP
  SNFLYNRRLKKYALVDFGLAQGTHDTKIELLKFVQSEAQQERCSQNKSHIITGNKIPLSG
  PVPKELDQQSTTKASVKRPYTNAQIQIKQGKDGKEGSVGLSVQRSVFGERNFNIHSSISH
  ESPAVKLMKQSKTVDVLSRKLATKKKAISTKVMNSAVMRKTASSCPASLTCDCYATDKVC
  SICLSRRQQVAPRAGTPGFRAPEVLTKCPNQTTAIDMWSAGVIFLSLLSGRYPFYKASDD
  LTALAQIMTIRGSRETIQAAKTFGKSILCSKEVPAQDLRKLCERLRGMDSSTPKLTSDIQ
  GHASHQPAISEKTDHKASCLVQTPPGQYSGNSFKKGDSNSCEHCFDEYNTNLEGWNEVPD
  EAYDLLDKLLDLNPASRITAEEALLHPFFKDMSL

• Sequence length: 574

Pathways

KEGG:

Cell cycle

Reactome:

Activation of ATR in response to replication stress
Activation of the pre-replicative complex
Transcriptional Regulation by E2F6

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
MENTAL OR BEHAVIOURAL DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Premature ovarian insufficiency	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31002360		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	26921250		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	30413320	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	23424178		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	32628315	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia	Ataxia	Pubtator	18714392	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	16446360	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20724597, 30823486, 31262335		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18714392, 20724597, 30823486, 33066779	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms Male	Male breast neoplasms	Pubtator	30850364	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20724597	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30363964, 36609254	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	27144525	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19318489		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30150654		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30150654		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21768328		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23716994		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23716994, 26208856	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	22806309		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	23424178		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	32628315	Associate	★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	23424178		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	21427129		★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	25798827, 25861811	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	25798827, 25861811, 26383992		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29413763		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29413763		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	18714392	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	25748237	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20724597, 30823486, 31262335		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19318489		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	26921250		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18084324, 19815406, 23684929, 24841992, 28533114, 29134273, 29209046, 29413763, 29984527, 30293817, 31402912, 31578454		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30150654		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	17597816, 31578454	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31578454		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	31578454		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	31289205, 33197893	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15466207, 19318489, 20647475, 20724597, 23684929, 29339028, 29413763, 30150654		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	19318489		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34020950	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	26921250		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	26921250	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	29339028	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	23684929, 29713760		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30588031		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25475780	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	20724597, 31262335		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	31262335	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	30150654	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	30150654	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33763482	Stimulate	★☆☆☆☆ Found in Text Mining only