Gene Gene information from NCBI Gene database.
Entrez ID 8302
Gene name Killer cell lectin like receptor C4
Gene symbol KLRC4
Synonyms (NCBI Gene)
NKG2-FNKG2F
Chromosome 12
Chromosome location 12p13.2
Summary Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calci
miRNA miRNA information provided by mirtarbase database.
11
miRTarBase ID miRNA Experiments Reference
MIRT018052 hsa-miR-335-5p Microarray 18185580
MIRT025173 hsa-miR-181a-5p Microarray 17612493
MIRT029577 hsa-miR-26b-5p Microarray 19088304
MIRT450180 hsa-miR-302a-5p PAR-CLIP 22100165
MIRT448698 hsa-miR-570-3p PAR-CLIP 22100165
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
GO ID Ontology Definition Evidence Reference
GO:0002223 Process Stimulatory C-type lectin receptor signaling pathway IBA
GO:0004888 Function Transmembrane signaling receptor activity IBA
GO:0009897 Component External side of plasma membrane IBA
GO:0016020 Component Membrane IEA
GO:0045954 Process Positive regulation of natural killer cell mediated cytotoxicity IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602893 6377 ENSG00000183542
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O43908
Protein name NKG2-F type II integral membrane protein (NK cell receptor F) (NKG2-F-activating NK receptor)
Protein function May play a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Natural killer cells.
Sequence
MNKQRGTYSEVSLAQDPKRQQRKLKGNKISISGTKQEIFQVELNLQNASSDHQGNDKTYH
CKGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPCIGVLEQNNFSLNRRMQKARHCGHC
PEEWITYSNSCYYIGKERRTWEERVCWPVLRRTLICFL
Sequence length 158
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Antigen processing and presentation  
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
4
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Behcet disease Orphanet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BEHCET SYNDROME CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BEHCET'S SYNDROME GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
LEUKEMIA, LYMPHOCYTIC, CHRONIC, B-CELL CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acne Acne HPO_DG
★☆☆☆☆
Found in Text Mining only
Anorexia Anorexia HPO_DG
★☆☆☆☆
Found in Text Mining only
Aortic Valve Insufficiency Aortic Valve Insufficiency HPO_DG
★☆☆☆☆
Found in Text Mining only
Arthritis Arthritis HPO_DG
★☆☆☆☆
Found in Text Mining only
Behcet Syndrome Orphanet
★☆☆☆☆
Found in Text Mining only
Behcet Syndrome Behcet Syndrome CTD_human_DG 23291587
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Behcet Syndrome Behcet Syndrome GWASCAT_DG 23291587
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Behcet Syndrome Behcet Syndrome GWASDB_DG 23291587
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Behcet Syndrome Behcet Syndrome BEFREE 23633568, 26097239, 28706259
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Behcet Syndrome Behcet Syndrome ORPHANET_DG 26097239
★★☆☆☆
Found in Text Mining + Unknown/Other Associations