Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8301
Gene name	Phosphatidylinositol binding clathrin assembly protein
Gene symbol	PICALM
Synonyms (NCBI Gene)	CALMCLTHLAP
Chromosome	11
Chromosome location	11q14.2
Summary	This gene encodes a clathrin assembly protein, which recruits clathrin and adaptor protein complex 2 (AP2) to cell membranes at sites of coated-pit formation and clathrin-vesicle assembly. The protein may be required to determine the amount of membrane to

333

Show/Hide all (333)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001525	hsa-miR-155-5p	pSILAC	18668040
MIRT001350	hsa-miR-1-3p	pSILAC	18668040
MIRT001525	hsa-miR-155-5p	Reporter assay;Other	20584899
MIRT001525	hsa-miR-155-5p	Proteomics	18668040
MIRT023209	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT001350	hsa-miR-1-3p	Proteomics;Microarray	18668037
MIRT001350	hsa-miR-1-3p	Proteomics	18668040
MIRT027784	hsa-miR-98-5p	Microarray	19088304
MIRT028681	hsa-miR-30a-5p	Proteomics	18668040
MIRT720649	hsa-miR-4760-3p	HITS-CLIP	19536157
MIRT720648	hsa-miR-3163	HITS-CLIP	19536157
MIRT720647	hsa-miR-5007-3p	HITS-CLIP	19536157
MIRT720646	hsa-miR-510-3p	HITS-CLIP	19536157
MIRT028681	hsa-miR-30a-5p	PAR-CLIP	21572407
MIRT555616	hsa-miR-30b-5p	PAR-CLIP	21572407
MIRT555615	hsa-miR-30c-5p	PAR-CLIP	21572407
MIRT555614	hsa-miR-30e-5p	PAR-CLIP	21572407
MIRT555613	hsa-miR-30d-5p	PAR-CLIP	21572407
MIRT555612	hsa-miR-3121-3p	PAR-CLIP	21572407
MIRT383754	hsa-miR-3158-5p	PAR-CLIP	21572407
MIRT555611	hsa-miR-1184	PAR-CLIP	21572407
MIRT555610	hsa-miR-1205	PAR-CLIP	21572407
MIRT555609	hsa-miR-17-3p	PAR-CLIP	21572407
MIRT182907	hsa-miR-889-3p	PAR-CLIP	21572407
MIRT439979	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT001525	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT439978	hsa-miR-205-5p	HITS-CLIP	22473208
MIRT439979	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT001525	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT439978	hsa-miR-205-5p	HITS-CLIP	22473208
MIRT028681	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT555616	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT555615	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT555613	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT555614	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT735734	hsa-miR-155-3p	Luciferase reporter assayWestern blottingqRT-PCR	31853228
MIRT735931	hsa-miR-1265	Luciferase reporter assayWestern blottingImmunoprecipitaion (IP)qRT-PCRIn situ hybridization	31648990
MIRT720649	hsa-miR-4760-3p	HITS-CLIP	19536157
MIRT720648	hsa-miR-3163	HITS-CLIP	19536157
MIRT720647	hsa-miR-5007-3p	HITS-CLIP	19536157
MIRT720646	hsa-miR-510-3p	HITS-CLIP	19536157
MIRT028681	hsa-miR-30a-5p	PAR-CLIP	21572407
MIRT555616	hsa-miR-30b-5p	PAR-CLIP	21572407
MIRT555615	hsa-miR-30c-5p	PAR-CLIP	21572407
MIRT555614	hsa-miR-30e-5p	PAR-CLIP	21572407
MIRT555613	hsa-miR-30d-5p	PAR-CLIP	21572407
MIRT555612	hsa-miR-3121-3p	PAR-CLIP	21572407
MIRT383754	hsa-miR-3158-5p	PAR-CLIP	21572407
MIRT555611	hsa-miR-1184	PAR-CLIP	21572407
MIRT555610	hsa-miR-1205	PAR-CLIP	21572407
MIRT555609	hsa-miR-17-3p	PAR-CLIP	21572407
MIRT182907	hsa-miR-889-3p	PAR-CLIP	21572407
MIRT1232962	hsa-miR-3120-3p	CLIP-seq
MIRT1232963	hsa-miR-3198	CLIP-seq
MIRT1232964	hsa-miR-4309	CLIP-seq
MIRT1232965	hsa-miR-4705	CLIP-seq
MIRT1232966	hsa-miR-511	CLIP-seq
MIRT1232967	hsa-miR-515-5p	CLIP-seq
MIRT1232968	hsa-miR-545	CLIP-seq
MIRT1232969	hsa-miR-103b	CLIP-seq
MIRT1232970	hsa-miR-1261	CLIP-seq
MIRT1232971	hsa-miR-1298	CLIP-seq
MIRT1232972	hsa-miR-148a	CLIP-seq
MIRT1232973	hsa-miR-148b	CLIP-seq
MIRT1232974	hsa-miR-152	CLIP-seq
MIRT1232975	hsa-miR-154	CLIP-seq
MIRT1232976	hsa-miR-186	CLIP-seq
MIRT1232977	hsa-miR-2113	CLIP-seq
MIRT1232978	hsa-miR-219-1-3p	CLIP-seq
MIRT1232979	hsa-miR-3115	CLIP-seq
MIRT1232980	hsa-miR-3119	CLIP-seq
MIRT1232981	hsa-miR-3158-3p	CLIP-seq
MIRT1232982	hsa-miR-3179	CLIP-seq
MIRT1232983	hsa-miR-3190	CLIP-seq
MIRT1232984	hsa-miR-340	CLIP-seq
MIRT1232985	hsa-miR-3647-3p	CLIP-seq
MIRT1232986	hsa-miR-3691-5p	CLIP-seq
MIRT1232987	hsa-miR-3908	CLIP-seq
MIRT1232988	hsa-miR-3920	CLIP-seq
MIRT1232989	hsa-miR-3942-5p	CLIP-seq
MIRT1232990	hsa-miR-421	CLIP-seq
MIRT1232991	hsa-miR-4305	CLIP-seq
MIRT1232992	hsa-miR-4433	CLIP-seq
MIRT1232993	hsa-miR-4474-5p	CLIP-seq
MIRT1232994	hsa-miR-4639-5p	CLIP-seq
MIRT1232995	hsa-miR-4668-3p	CLIP-seq
MIRT1232996	hsa-miR-4703-5p	CLIP-seq
MIRT1232997	hsa-miR-4709-5p	CLIP-seq
MIRT1232998	hsa-miR-4742-3p	CLIP-seq
MIRT1232999	hsa-miR-4752	CLIP-seq
MIRT1233000	hsa-miR-4766-3p	CLIP-seq
MIRT1233001	hsa-miR-4803	CLIP-seq
MIRT1233002	hsa-miR-488	CLIP-seq
MIRT1233003	hsa-miR-526b	CLIP-seq
MIRT1233004	hsa-miR-548c-3p	CLIP-seq
MIRT1233005	hsa-miR-548g	CLIP-seq
MIRT1233006	hsa-miR-578	CLIP-seq
MIRT1233007	hsa-miR-581	CLIP-seq
MIRT1233008	hsa-miR-660	CLIP-seq
MIRT1233009	hsa-miR-664	CLIP-seq
MIRT1233010	hsa-miR-671-5p	CLIP-seq
MIRT2068547	hsa-miR-1224-5p	CLIP-seq
MIRT2068548	hsa-miR-1287	CLIP-seq
MIRT2068549	hsa-miR-1290	CLIP-seq
MIRT2068550	hsa-miR-1294	CLIP-seq
MIRT1232975	hsa-miR-154	CLIP-seq
MIRT2068551	hsa-miR-155	CLIP-seq
MIRT1232980	hsa-miR-3119	CLIP-seq
MIRT2068552	hsa-miR-3135b	CLIP-seq
MIRT2068553	hsa-miR-3148	CLIP-seq
MIRT1232981	hsa-miR-3158-3p	CLIP-seq
MIRT2068554	hsa-miR-3162-5p	CLIP-seq
MIRT2068555	hsa-miR-3167	CLIP-seq
MIRT2068556	hsa-miR-3169	CLIP-seq
MIRT2068557	hsa-miR-3173-3p	CLIP-seq
MIRT2068558	hsa-miR-330-3p	CLIP-seq
MIRT2068559	hsa-miR-337-3p	CLIP-seq
MIRT2068560	hsa-miR-338-5p	CLIP-seq
MIRT2068561	hsa-miR-34b	CLIP-seq
MIRT2068562	hsa-miR-3622a-3p	CLIP-seq
MIRT2068563	hsa-miR-3622b-3p	CLIP-seq
MIRT1232985	hsa-miR-3647-3p	CLIP-seq
MIRT2068564	hsa-miR-3662	CLIP-seq
MIRT2068565	hsa-miR-3667-3p	CLIP-seq
MIRT2068566	hsa-miR-3686	CLIP-seq
MIRT2068567	hsa-miR-377	CLIP-seq
MIRT1232988	hsa-miR-3920	CLIP-seq
MIRT2068568	hsa-miR-4279	CLIP-seq
MIRT2068569	hsa-miR-4316	CLIP-seq
MIRT2068570	hsa-miR-4318	CLIP-seq
MIRT2068571	hsa-miR-4427	CLIP-seq
MIRT2068572	hsa-miR-4428	CLIP-seq
MIRT2068573	hsa-miR-4434	CLIP-seq
MIRT2068574	hsa-miR-4480	CLIP-seq
MIRT2068575	hsa-miR-4515	CLIP-seq
MIRT2068576	hsa-miR-4516	CLIP-seq
MIRT2068577	hsa-miR-4531	CLIP-seq
MIRT2068578	hsa-miR-4652-3p	CLIP-seq
MIRT2068579	hsa-miR-4666-3p	CLIP-seq
MIRT2068580	hsa-miR-4668-5p	CLIP-seq
MIRT2068581	hsa-miR-4693-5p	CLIP-seq
MIRT2068582	hsa-miR-4728-3p	CLIP-seq
MIRT1232998	hsa-miR-4742-3p	CLIP-seq
MIRT2068583	hsa-miR-4751	CLIP-seq
MIRT2068584	hsa-miR-4775	CLIP-seq
MIRT2068585	hsa-miR-513a-3p	CLIP-seq
MIRT1233003	hsa-miR-526b	CLIP-seq
MIRT1233006	hsa-miR-578	CLIP-seq
MIRT2068586	hsa-miR-758	CLIP-seq
MIRT2068587	hsa-miR-876-5p	CLIP-seq
MIRT2068588	hsa-miR-892a	CLIP-seq
MIRT2068589	hsa-miR-935	CLIP-seq
MIRT2295689	hsa-miR-1179	CLIP-seq
MIRT1232971	hsa-miR-1298	CLIP-seq
MIRT2295690	hsa-miR-1323	CLIP-seq
MIRT2295691	hsa-miR-142-3p	CLIP-seq
MIRT2068551	hsa-miR-155	CLIP-seq
MIRT2295692	hsa-miR-205	CLIP-seq
MIRT1232977	hsa-miR-2113	CLIP-seq
MIRT2295693	hsa-miR-2681	CLIP-seq
MIRT2295694	hsa-miR-2861	CLIP-seq
MIRT1232980	hsa-miR-3119	CLIP-seq
MIRT2295695	hsa-miR-3140-3p	CLIP-seq
MIRT2068557	hsa-miR-3173-3p	CLIP-seq
MIRT1232983	hsa-miR-3190	CLIP-seq
MIRT2068558	hsa-miR-330-3p	CLIP-seq
MIRT2068559	hsa-miR-337-3p	CLIP-seq
MIRT1232984	hsa-miR-340	CLIP-seq
MIRT2295696	hsa-miR-3609	CLIP-seq
MIRT2068564	hsa-miR-3662	CLIP-seq
MIRT2295697	hsa-miR-3685	CLIP-seq
MIRT2295698	hsa-miR-384	CLIP-seq
MIRT1232987	hsa-miR-3908	CLIP-seq
MIRT1232989	hsa-miR-3942-5p	CLIP-seq
MIRT2068568	hsa-miR-4279	CLIP-seq
MIRT2068570	hsa-miR-4318	CLIP-seq
MIRT2295699	hsa-miR-4420	CLIP-seq
MIRT2295700	hsa-miR-4424	CLIP-seq
MIRT2068571	hsa-miR-4427	CLIP-seq
MIRT2068572	hsa-miR-4428	CLIP-seq
MIRT2295701	hsa-miR-4473	CLIP-seq
MIRT2295702	hsa-miR-4517	CLIP-seq
MIRT1232994	hsa-miR-4639-5p	CLIP-seq
MIRT1232995	hsa-miR-4668-3p	CLIP-seq
MIRT2295703	hsa-miR-4680-3p	CLIP-seq
MIRT2295704	hsa-miR-4682	CLIP-seq
MIRT2068581	hsa-miR-4693-5p	CLIP-seq
MIRT1232996	hsa-miR-4703-5p	CLIP-seq
MIRT2068582	hsa-miR-4728-3p	CLIP-seq
MIRT1232998	hsa-miR-4742-3p	CLIP-seq
MIRT1232999	hsa-miR-4752	CLIP-seq
MIRT1233000	hsa-miR-4766-3p	CLIP-seq
MIRT1233001	hsa-miR-4803	CLIP-seq
MIRT2295705	hsa-miR-495	CLIP-seq
MIRT2295706	hsa-miR-512-3p	CLIP-seq
MIRT2295707	hsa-miR-520f	CLIP-seq
MIRT2295708	hsa-miR-548ah	CLIP-seq
MIRT1233005	hsa-miR-548g	CLIP-seq
MIRT2295709	hsa-miR-548o	CLIP-seq
MIRT2295710	hsa-miR-548t	CLIP-seq
MIRT1233006	hsa-miR-578	CLIP-seq
MIRT1233009	hsa-miR-664	CLIP-seq
MIRT1233010	hsa-miR-671-5p	CLIP-seq
MIRT2068588	hsa-miR-892a	CLIP-seq
MIRT2456451	hsa-miR-188-3p	CLIP-seq
MIRT2456452	hsa-miR-605	CLIP-seq
MIRT2593493	hsa-miR-1	CLIP-seq
MIRT2295689	hsa-miR-1179	CLIP-seq
MIRT2593494	hsa-miR-1470	CLIP-seq
MIRT1232975	hsa-miR-154	CLIP-seq
MIRT1232976	hsa-miR-186	CLIP-seq
MIRT2295692	hsa-miR-205	CLIP-seq
MIRT2593495	hsa-miR-206	CLIP-seq
MIRT2593496	hsa-miR-2114	CLIP-seq
MIRT2593497	hsa-miR-217	CLIP-seq
MIRT1232978	hsa-miR-219-1-3p	CLIP-seq
MIRT2295694	hsa-miR-2861	CLIP-seq
MIRT1232979	hsa-miR-3115	CLIP-seq
MIRT1232980	hsa-miR-3119	CLIP-seq
MIRT2593498	hsa-miR-3127-3p	CLIP-seq
MIRT2068553	hsa-miR-3148	CLIP-seq
MIRT1232981	hsa-miR-3158-3p	CLIP-seq
MIRT2593499	hsa-miR-3161	CLIP-seq
MIRT1232982	hsa-miR-3179	CLIP-seq
MIRT2593500	hsa-miR-3185	CLIP-seq
MIRT2068559	hsa-miR-337-3p	CLIP-seq
MIRT2068560	hsa-miR-338-5p	CLIP-seq
MIRT2593501	hsa-miR-3618	CLIP-seq
MIRT2593502	hsa-miR-3646	CLIP-seq
MIRT1232985	hsa-miR-3647-3p	CLIP-seq
MIRT2068564	hsa-miR-3662	CLIP-seq
MIRT2068567	hsa-miR-377	CLIP-seq
MIRT2593503	hsa-miR-380	CLIP-seq
MIRT1232988	hsa-miR-3920	CLIP-seq
MIRT2593504	hsa-miR-3924	CLIP-seq
MIRT2593505	hsa-miR-3925-3p	CLIP-seq
MIRT2593506	hsa-miR-409-3p	CLIP-seq
MIRT2593507	hsa-miR-4277	CLIP-seq
MIRT2068568	hsa-miR-4279	CLIP-seq
MIRT2593508	hsa-miR-4282	CLIP-seq
MIRT2593509	hsa-miR-4313	CLIP-seq
MIRT2593510	hsa-miR-4330	CLIP-seq
MIRT2593511	hsa-miR-4418	CLIP-seq
MIRT2295699	hsa-miR-4420	CLIP-seq
MIRT2295700	hsa-miR-4424	CLIP-seq
MIRT2068571	hsa-miR-4427	CLIP-seq
MIRT1232992	hsa-miR-4433	CLIP-seq
MIRT2593512	hsa-miR-4477b	CLIP-seq
MIRT2593513	hsa-miR-4495	CLIP-seq
MIRT2593514	hsa-miR-4514	CLIP-seq
MIRT2593515	hsa-miR-4645-5p	CLIP-seq
MIRT2593516	hsa-miR-4659a-3p	CLIP-seq
MIRT2593517	hsa-miR-4659b-3p	CLIP-seq
MIRT2068579	hsa-miR-4666-3p	CLIP-seq
MIRT2593518	hsa-miR-4667-3p	CLIP-seq
MIRT2593519	hsa-miR-4673	CLIP-seq
MIRT2295704	hsa-miR-4682	CLIP-seq
MIRT2593520	hsa-miR-4692	CLIP-seq
MIRT2593521	hsa-miR-4768-5p	CLIP-seq
MIRT2068584	hsa-miR-4775	CLIP-seq
MIRT1233002	hsa-miR-488	CLIP-seq
MIRT2593522	hsa-miR-509-3-5p	CLIP-seq
MIRT2593523	hsa-miR-509-5p	CLIP-seq
MIRT2068585	hsa-miR-513a-3p	CLIP-seq
MIRT1233003	hsa-miR-526b	CLIP-seq
MIRT2593524	hsa-miR-554	CLIP-seq
MIRT2593525	hsa-miR-564	CLIP-seq
MIRT2593526	hsa-miR-576-5p	CLIP-seq
MIRT1233006	hsa-miR-578	CLIP-seq
MIRT2593527	hsa-miR-590-3p	CLIP-seq
MIRT2593528	hsa-miR-613	CLIP-seq
MIRT2593529	hsa-miR-642a	CLIP-seq
MIRT2593530	hsa-miR-7	CLIP-seq
MIRT2593531	hsa-miR-766	CLIP-seq
MIRT2593532	hsa-miR-934	CLIP-seq
MIRT2593533	hsa-miR-942	CLIP-seq
MIRT2593493	hsa-miR-1	CLIP-seq
MIRT2295689	hsa-miR-1179	CLIP-seq
MIRT2593494	hsa-miR-1470	CLIP-seq
MIRT1232975	hsa-miR-154	CLIP-seq
MIRT1232976	hsa-miR-186	CLIP-seq
MIRT2687868	hsa-miR-194	CLIP-seq
MIRT2295692	hsa-miR-205	CLIP-seq
MIRT2593495	hsa-miR-206	CLIP-seq
MIRT2593496	hsa-miR-2114	CLIP-seq
MIRT1232978	hsa-miR-219-1-3p	CLIP-seq
MIRT2295694	hsa-miR-2861	CLIP-seq
MIRT1232979	hsa-miR-3115	CLIP-seq
MIRT1232980	hsa-miR-3119	CLIP-seq
MIRT2593498	hsa-miR-3127-3p	CLIP-seq
MIRT1232981	hsa-miR-3158-3p	CLIP-seq
MIRT2593499	hsa-miR-3161	CLIP-seq
MIRT2593500	hsa-miR-3185	CLIP-seq
MIRT2068559	hsa-miR-337-3p	CLIP-seq
MIRT2068560	hsa-miR-338-5p	CLIP-seq
MIRT1232985	hsa-miR-3647-3p	CLIP-seq
MIRT2068567	hsa-miR-377	CLIP-seq
MIRT2593503	hsa-miR-380	CLIP-seq
MIRT1232988	hsa-miR-3920	CLIP-seq
MIRT2593504	hsa-miR-3924	CLIP-seq
MIRT2593505	hsa-miR-3925-3p	CLIP-seq
MIRT2593506	hsa-miR-409-3p	CLIP-seq
MIRT2593507	hsa-miR-4277	CLIP-seq
MIRT2068568	hsa-miR-4279	CLIP-seq
MIRT2593508	hsa-miR-4282	CLIP-seq
MIRT2593509	hsa-miR-4313	CLIP-seq
MIRT2295699	hsa-miR-4420	CLIP-seq
MIRT2295700	hsa-miR-4424	CLIP-seq
MIRT1232992	hsa-miR-4433	CLIP-seq
MIRT2593512	hsa-miR-4477b	CLIP-seq
MIRT2593513	hsa-miR-4495	CLIP-seq
MIRT2593514	hsa-miR-4514	CLIP-seq
MIRT2593515	hsa-miR-4645-5p	CLIP-seq
MIRT2593516	hsa-miR-4659a-3p	CLIP-seq
MIRT2593517	hsa-miR-4659b-3p	CLIP-seq
MIRT2068579	hsa-miR-4666-3p	CLIP-seq
MIRT2593518	hsa-miR-4667-3p	CLIP-seq
MIRT2593519	hsa-miR-4673	CLIP-seq
MIRT2295704	hsa-miR-4682	CLIP-seq
MIRT2593520	hsa-miR-4692	CLIP-seq
MIRT2593521	hsa-miR-4768-5p	CLIP-seq
MIRT1233002	hsa-miR-488	CLIP-seq
MIRT2068585	hsa-miR-513a-3p	CLIP-seq
MIRT1233003	hsa-miR-526b	CLIP-seq
MIRT2593524	hsa-miR-554	CLIP-seq
MIRT2593525	hsa-miR-564	CLIP-seq
MIRT2593526	hsa-miR-576-5p	CLIP-seq
MIRT1233006	hsa-miR-578	CLIP-seq
MIRT2593528	hsa-miR-613	CLIP-seq
MIRT2593529	hsa-miR-642a	CLIP-seq
MIRT2593530	hsa-miR-7	CLIP-seq
MIRT2593531	hsa-miR-766	CLIP-seq
MIRT2593533	hsa-miR-942	CLIP-seq

Show/Hide all (97)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000149	Function	SNARE binding	IBA
GO:0000149	Function	SNARE binding	IDA	22118466
GO:0001540	Function	Amyloid-beta binding	IC
GO:0005515	Function	Protein binding	IPI	16262731, 16491119, 22118466, 22829078, 23382074, 26496610, 32296183, 35044719
GO:0005543	Function	Phospholipid binding	IEA
GO:0005545	Function	1-phosphatidylinositol binding	IBA
GO:0005545	Function	1-phosphatidylinositol binding	IEA
GO:0005545	Function	1-phosphatidylinositol binding	ISS
GO:0005546	Function	Phosphatidylinositol-4,5-bisphosphate binding	IBA
GO:0005546	Function	Phosphatidylinositol-4,5-bisphosphate binding	ISS	25898166
GO:0005634	Component	Nucleus	IDA	16491119
GO:0005634	Component	Nucleus	IEA
GO:0005769	Component	Early endosome	IDA	26005850
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	16262731
GO:0005886	Component	Plasma membrane	IEA
GO:0005905	Component	Clathrin-coated pit	IBA
GO:0005905	Component	Clathrin-coated pit	IDA	10436022
GO:0005905	Component	Clathrin-coated pit	IEA
GO:0005905	Component	Clathrin-coated pit	IMP	25898166
GO:0006879	Process	Intracellular iron ion homeostasis	IMP	22952941
GO:0006897	Process	Endocytosis	IDA	22118466
GO:0006897	Process	Endocytosis	IEA
GO:0006898	Process	Receptor-mediated endocytosis	IDA	10436022
GO:0006898	Process	Receptor-mediated endocytosis	IEA
GO:0006900	Process	Vesicle budding from membrane	IBA
GO:0006900	Process	Vesicle budding from membrane	IMP	25898166
GO:0007409	Process	Axonogenesis	IEA
GO:0007611	Process	Learning or memory	IEA
GO:0007611	Process	Learning or memory	ISS	26005850
GO:0008021	Component	Synaptic vesicle	IBA
GO:0009986	Component	Cell surface	IDA	26005850
GO:0010629	Process	Negative regulation of gene expression	IMP	22952941
GO:0012505	Component	Endomembrane system	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	ISS	25898166
GO:0016188	Process	Synaptic vesicle maturation	IEA
GO:0016188	Process	Synaptic vesicle maturation	ISS
GO:0016192	Process	Vesicle-mediated transport	TAS	8643484
GO:0016197	Process	Endosomal transport	IMP	16262731
GO:0030097	Process	Hemopoiesis	IEA
GO:0030100	Process	Regulation of endocytosis	IMP	18182011
GO:0030132	Component	Clathrin coat of coated pit	IDA	10436022, 16262731
GO:0030136	Component	Clathrin-coated vesicle	IBA
GO:0030136	Component	Clathrin-coated vesicle	IEA
GO:0030136	Component	Clathrin-coated vesicle	IMP	25898166
GO:0030276	Function	Clathrin binding	IDA	10436022, 16262731
GO:0030276	Function	Clathrin binding	IEA
GO:0031267	Function	Small GTPase binding	IPI	26005850
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031623	Process	Receptor internalization	IMP	14985334, 25898166
GO:0031982	Component	Vesicle	IEA
GO:0031982	Component	Vesicle	ISS
GO:0032050	Function	Clathrin heavy chain binding	IBA
GO:0032050	Function	Clathrin heavy chain binding	IDA	10436022
GO:0032880	Process	Regulation of protein localization	IDA	10436022
GO:0035459	Process	Vesicle cargo loading	IEA
GO:0035459	Process	Vesicle cargo loading	IMP	24577224
GO:0042734	Component	Presynaptic membrane	ISS
GO:0043025	Component	Neuronal cell body	IDA	23589030
GO:0045211	Component	Postsynaptic membrane	ISS
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045334	Component	Clathrin-coated endocytic vesicle	NAS	25898166
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	11425879
GO:0046579	Process	Positive regulation of Ras protein signal transduction	IMP	26005850
GO:0048156	Function	Tau protein binding	IPI	23589030
GO:0048259	Process	Regulation of receptor-mediated endocytosis	IEA
GO:0048261	Process	Negative regulation of receptor-mediated endocytosis	IDA	10436022
GO:0048268	Process	Clathrin coat assembly	IDA	16262731
GO:0048268	Process	Clathrin coat assembly	IEA
GO:0048268	Process	Clathrin coat assembly	IMP	16262731
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0048813	Process	Dendrite morphogenesis	IEA
GO:0050750	Function	Low-density lipoprotein particle receptor binding	IPI	26005850
GO:0060586	Process	Multicellular organismal-level iron ion homeostasis	IMP	22952941
GO:0065003	Process	Protein-containing complex assembly	TAS	8643484
GO:0070381	Component	Endosome to plasma membrane transport vesicle	IDA	26005850
GO:0072583	Process	Clathrin-dependent endocytosis	IBA
GO:0072583	Process	Clathrin-dependent endocytosis	IEA
GO:0072583	Process	Clathrin-dependent endocytosis	IMP	22952941, 24577224, 26005850
GO:0097418	Component	Neurofibrillary tangle	IMP	23589030
GO:0097494	Process	Regulation of vesicle size	IMP	25898166
GO:0097753	Process	Membrane bending	IMP	25898166
GO:0098894	Component	Extrinsic component of presynaptic endocytic zone membrane	IBA
GO:0150093	Process	Amyloid-beta clearance by transcytosis	IEA
GO:0150093	Process	Amyloid-beta clearance by transcytosis	IGI	26005850
GO:0150093	Process	Amyloid-beta clearance by transcytosis	ISS	26005850
GO:1902003	Process	Regulation of amyloid-beta formation	ISS	26005850
GO:1902004	Process	Positive regulation of amyloid-beta formation	IMP	24577224
GO:1902991	Process	Regulation of amyloid precursor protein catabolic process	IMP	24577224
GO:1902993	Process	Positive regulation of amyloid precursor protein catabolic process	IEA
GO:1902993	Process	Positive regulation of amyloid precursor protein catabolic process	ISS
GO:1903077	Process	Negative regulation of protein localization to plasma membrane	IMP	21221849
GO:2000009	Process	Negative regulation of protein localization to cell surface	IMP	21221849

MIM	HGNC	e!Ensembl
603025	15514	ENSG00000073921

Q13492

Protein name

Phosphatidylinositol-binding clathrin assembly protein (Clathrin assembly lymphoid myeloid leukemia protein)

Protein function

Cytoplasmic adapter protein that plays a critical role in clathrin-mediated endocytosis which is important in processes such as internalization of cell receptors, synaptic transmission or removal of apoptotic cells. Recruits AP-2 and attaches cl

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07651	ANTH	21 → 284	ANTH domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in all tissues examined. {ECO:0000269|PubMed:8643484}.

Sequence

MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLA
DSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDM
STFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKF
LTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKKIKDSTAASRAT
TLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGD
PFSATVDAVDDAIPSLNPFLTKSSGDVHLSISSDVSTFTTRTPTHEMFVGFTPSPVAQPH
PSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDL
DSSLANLVGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMAPPVMAY
PATTPTGMIGYGIPPQMGSVPVMTQPTLIYSQPVMRPPNPFGPVSGAQIQFM

Sequence length

652

Interactions

View interactions

	Reactome
			Golgi Associated Vesicle Biogenesis Cargo recognition for clathrin-mediated endocytosis Clathrin-mediated endocytosis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (21)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMERS DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COGNITIVE DYSFUNCTION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, ACUTE MYELOID	—	HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Marfanoid habitus and intellectual disability	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PICALM-related disorder	Likely benign; Uncertain significance; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (95)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	19734902, 21460841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	16518848, 16956826, 17804713, 18094714, 20007546, 20875875, 22871473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	10637482, 10637483, 16491119, 20875875, 23831922, 29189509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	11417476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	LHGDN	17170719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10637482, 16491119, 20875875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	10637482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	22871473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	19734902, 20209083, 20534741, 20554627, 20697030, 20739100, 20838239, 21059989, 21220176, 21379329, 21912625, 22015308, 22445811, 22482808, 22508715 View all (47 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	19734902, 21460841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	20951388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	19734902, 21460841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	20460622, 20554627, 20739100, 21132329, 21152065, 21321396, 21912625, 22015308, 22402018, 22722634, 22935915, 23643458, 23954108, 24095218, 25022885 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	19734902, 21460841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASDB_DG	22832961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	22832961, 25778476, 29777097, 30617256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	19734902, 21460841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	20080314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	33953791	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	29800622, 29852309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	29300100, 29800622, 29852309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arrhythmias Cardiac	Cardiac arrhythmias	Pubtator	30348784, 37528649	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	24670887, 27117083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	24613704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	37528649	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	24613704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	40442227	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	26159191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	10637482, 16491119, 20875875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	10637482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	22952074, 26889634, 27117083, 30472946	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	25189118	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	11911106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	21297263, 26159191		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dementia	Dementia	Pubtator	21297263, 30830563, 36191742, 36982820	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dementia Vascular	Vascular dementia	Pubtator	30830563	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	33386803	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28316001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	22871473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	LHGDN	17170719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	23601808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	23601808	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy Frontal Lobe	Frontal lobe epilepsy	Pubtator	27117083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Tremor	Tremor	BEFREE	31244760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	19734902, 21460841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	24670887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	26159191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	37528649	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	29774507, 9737689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	39499083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	23487024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	21390209, 22952074, 24613704, 26889634, 28631188, 30040717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	CTD_human_DG	30503753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning Disorders	BEFREE	28150585		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10637483, 11106826, 15774621, 18037964, 18094714, 19443658, 20007546, 21681188, 23284727, 23487024, 30670779, 31022428, 31141090, 9737689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	12461747, 23673860	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	17597474, 17804713, 18037964, 18094714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	12461747, 24498085, 39499083, 9616163	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10637482, 10637483, 16491119, 16518848, 20875875, 21681188, 22885519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	12461747, 17097559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Long QT Syndrome	Long qt syndrome	Pubtator	27765793	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Long QT Syndrome	Long QT Syndrome	BEFREE	28158429, 31170290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	16491119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10554802, 25027513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory disorders	Pubtator	29883038	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	25189118, 26159191, 28549650, 30503753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	CTD_human_DG	30503753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	11701946, 12676784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	30472946, 32062564, 33170153, 33386803	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	22715855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	28150585		★★★★★ ★☆☆☆☆ Found in Text Mining only
NEUROFIBROMATOSIS, TYPE 1-LIKE SYNDROME	Neurofibromatosis	BEFREE	28150585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	24788522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	21912625, 22715855, 23820587, 26889634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	21912625, 26889634	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	33386803	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal familial ventricular fibrillation	Paroxysmal ventricular fibrillation	BEFREE	31170290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	10637483, 23831922, 29189509, 31739126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-cell acute lymphoblastic leukemia	Lymphoblastic Leukemia	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	10637482, 10637483, 15637138, 23831922, 9737689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	ORPHANET_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	19734902, 21460841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	21297263, 26159191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	26159191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	36232302	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	20738160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	33397371	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	30830563	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tourette Syndrome	Tourette syndrome	Pubtator	28555406	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	31648990	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
VENTRICULAR TACHYCARDIA, CATECHOLAMINERGIC POLYMORPHIC, 1 (disorder)	Catecholaminergic polymorphic ventricular tachycardia	BEFREE	31170290		★★★★★ ★☆☆☆☆ Found in Text Mining only

PICALM (phosphatidylinositol binding clathrin assembly protein)