TMEM187 (transmembrane protein 187)

Gene

• Entrez ID: 8269
• Gene name: Transmembrane protein 187
• Gene symbol: TMEM187
• Synonyms (NCBI Gene): CXorf12, DXS9878E, ITBA1
• Chromosome: X
• Chromosome location: Xq28
• Summary: This gene consists of two exons and encodes a multi-pass membrane protein. An alternatively spliced transcript variant encoding the same protein has been found, but its biological validity is not determined. [provided by RefSeq, May 2010]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029254	hsa-miR-26b-5p	Microarray	19088304
MIRT1433877	hsa-miR-147	CLIP-seq
MIRT1433878	hsa-miR-148a	CLIP-seq
MIRT1433879	hsa-miR-148b	CLIP-seq
MIRT1433880	hsa-miR-152	CLIP-seq
MIRT1433881	hsa-miR-383	CLIP-seq
MIRT1433882	hsa-miR-3978	CLIP-seq
MIRT1433883	hsa-miR-4261	CLIP-seq
MIRT1433884	hsa-miR-4436b-3p	CLIP-seq
MIRT1433885	hsa-miR-4772-5p	CLIP-seq
MIRT1433886	hsa-miR-494	CLIP-seq
MIRT1433887	hsa-miR-581	CLIP-seq
MIRT1433888	hsa-miR-607	CLIP-seq
MIRT2351519	hsa-miR-873	CLIP-seq
MIRT2645192	hsa-miR-214	CLIP-seq
MIRT2645193	hsa-miR-3117-5p	CLIP-seq
MIRT2645194	hsa-miR-3619-5p	CLIP-seq
MIRT2645195	hsa-miR-4291	CLIP-seq
MIRT2645196	hsa-miR-4330	CLIP-seq
MIRT2645197	hsa-miR-4731-5p	CLIP-seq
MIRT2645198	hsa-miR-4769-3p	CLIP-seq
MIRT2645199	hsa-miR-637	CLIP-seq
MIRT2645200	hsa-miR-657	CLIP-seq
MIRT2645201	hsa-miR-759	CLIP-seq
MIRT2645202	hsa-miR-761	CLIP-seq
MIRT2645203	hsa-miR-922	CLIP-seq
MIRT2645193	hsa-miR-3117-5p	CLIP-seq
MIRT2645196	hsa-miR-4330	CLIP-seq
MIRT2645197	hsa-miR-4731-5p	CLIP-seq
MIRT2645198	hsa-miR-4769-3p	CLIP-seq
MIRT2645199	hsa-miR-637	CLIP-seq
MIRT2645201	hsa-miR-759	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0016020	Component	Membrane	IEA
GO:0030133	Component	Transport vesicle	IBA
GO:0030133	Component	Transport vesicle	IDA

Other IDs

• MIM: 300059
• HGNC: 13705
• e!Ensembl: ENSG00000177854

Protein

• UniProt ID: Q14656
• Protein name: Transmembrane protein 187 (Protein ITBA1)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15100	TMEM187	8 → 245	TMEM187 protein family	Family

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous.
• Sequence:

  MNPEWGQAFVHVAVAGGLCAVAVFTGIFDSVSVQVGYEHYAEAPVAGLPAFLAMPFNSLV
  NMAYTLLGLSWLHRGGAMGLGPRYLKDVFAAMALLYGPVQWLRLWTQWRRAAVLDQWLTL
  PIFAWPVAWCLYLDRGWRPWLFLSLECVSLASYGLALLHPQGFEVALGAHVVAAVGQALR
  THRHYGSTTSATYLALGVLSCLGFVVLKLCDHQLARWRLFQCLTGHFWSKVCDVLQFHFA
  FLFLTHFNTHPRFHPSGGKTR

• Sequence length: 261

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CELIAC DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTERNET ADDICTION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	28271077	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	31323913		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	GWASDB_DG	22057235, 23143596		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	GWASCAT_DG	22057235		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	Pubtator	26859134, 38072919	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	22904263		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	37710308	Associate	★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	31323913		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	23143596		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASCAT_DG	23143596		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28271077		★★☆☆☆ Found in Text Mining + Unknown/Other Associations