Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8237
Gene name	Ubiquitin specific peptidase 11
Gene symbol	USP11
Synonyms (NCBI Gene)	UHX1
Chromosome	X
Chromosome location	Xp11.3
Summary	Protein ubiquitination controls many intracellular processes, including cell cycle progression, transcriptional activation, and signal transduction. This dynamic process, involving ubiquitin conjugating enzymes and deubiquitinating enzymes, adds and remov

Show/Hide all (2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs777516785	G>A	Likely-pathogenic	Coding sequence variant, synonymous variant
rs780096892	G>A	Likely-pathogenic	Coding sequence variant, missense variant, 5 prime UTR variant

199

Show/Hide all (199)

miRTarBase ID	miRNA	Experiments	Reference
MIRT047695	hsa-miR-10a-5p	CLASH	23622248
MIRT1477415	hsa-miR-1207-5p	CLIP-seq
MIRT1477416	hsa-miR-1286	CLIP-seq
MIRT1477417	hsa-miR-1287	CLIP-seq
MIRT1477418	hsa-miR-1321	CLIP-seq
MIRT1477419	hsa-miR-1915	CLIP-seq
MIRT1477420	hsa-miR-2467-3p	CLIP-seq
MIRT1477421	hsa-miR-298	CLIP-seq
MIRT1477422	hsa-miR-3119	CLIP-seq
MIRT1477423	hsa-miR-3135b	CLIP-seq
MIRT1477424	hsa-miR-3150a-3p	CLIP-seq
MIRT1477425	hsa-miR-3154	CLIP-seq
MIRT1477426	hsa-miR-3158-3p	CLIP-seq
MIRT1477427	hsa-miR-3175	CLIP-seq
MIRT1477428	hsa-miR-3180	CLIP-seq
MIRT1477429	hsa-miR-3180-3p	CLIP-seq
MIRT1477430	hsa-miR-3196	CLIP-seq
MIRT1477431	hsa-miR-3202	CLIP-seq
MIRT1477432	hsa-miR-329	CLIP-seq
MIRT1477433	hsa-miR-362-3p	CLIP-seq
MIRT1477434	hsa-miR-3678-3p	CLIP-seq
MIRT1477435	hsa-miR-3688-5p	CLIP-seq
MIRT1477436	hsa-miR-3907	CLIP-seq
MIRT1477437	hsa-miR-3918	CLIP-seq
MIRT1477438	hsa-miR-3937	CLIP-seq
MIRT1477439	hsa-miR-3941	CLIP-seq
MIRT1477440	hsa-miR-4463	CLIP-seq
MIRT1477441	hsa-miR-4468	CLIP-seq
MIRT1477442	hsa-miR-4470	CLIP-seq
MIRT1477443	hsa-miR-4494	CLIP-seq
MIRT1477444	hsa-miR-4512	CLIP-seq
MIRT1477445	hsa-miR-4533	CLIP-seq
MIRT1477446	hsa-miR-4652-3p	CLIP-seq
MIRT1477447	hsa-miR-4685-5p	CLIP-seq
MIRT1477448	hsa-miR-4721	CLIP-seq
MIRT1477449	hsa-miR-4728-5p	CLIP-seq
MIRT1477450	hsa-miR-4736	CLIP-seq
MIRT1477451	hsa-miR-4739	CLIP-seq
MIRT1477452	hsa-miR-4756-5p	CLIP-seq
MIRT1477453	hsa-miR-4763-3p	CLIP-seq
MIRT1477454	hsa-miR-4768-3p	CLIP-seq
MIRT1477455	hsa-miR-4771	CLIP-seq
MIRT1477456	hsa-miR-4773	CLIP-seq
MIRT1477457	hsa-miR-4781-5p	CLIP-seq
MIRT1477458	hsa-miR-4789-5p	CLIP-seq
MIRT1477459	hsa-miR-548q	CLIP-seq
MIRT1477460	hsa-miR-548u	CLIP-seq
MIRT1477461	hsa-miR-603	CLIP-seq
MIRT1477462	hsa-miR-711	CLIP-seq
MIRT1477463	hsa-miR-744	CLIP-seq
MIRT1477464	hsa-miR-922	CLIP-seq
MIRT1477465	hsa-miR-939	CLIP-seq
MIRT2143773	hsa-miR-1285	CLIP-seq
MIRT2143774	hsa-miR-1587	CLIP-seq
MIRT2143775	hsa-miR-197	CLIP-seq
MIRT1477421	hsa-miR-298	CLIP-seq
MIRT2143776	hsa-miR-3150b-3p	CLIP-seq
MIRT2143777	hsa-miR-3187-5p	CLIP-seq
MIRT1477431	hsa-miR-3202	CLIP-seq
MIRT2143778	hsa-miR-326	CLIP-seq
MIRT2143779	hsa-miR-330-5p	CLIP-seq
MIRT2143780	hsa-miR-378g	CLIP-seq
MIRT1477437	hsa-miR-3918	CLIP-seq
MIRT2143781	hsa-miR-4486	CLIP-seq
MIRT2143782	hsa-miR-4492	CLIP-seq
MIRT2143783	hsa-miR-4498	CLIP-seq
MIRT1477444	hsa-miR-4512	CLIP-seq
MIRT2143784	hsa-miR-4656	CLIP-seq
MIRT2143785	hsa-miR-4675	CLIP-seq
MIRT2143786	hsa-miR-4689	CLIP-seq
MIRT2143787	hsa-miR-4741	CLIP-seq
MIRT2143788	hsa-miR-4747-5p	CLIP-seq
MIRT1477454	hsa-miR-4768-3p	CLIP-seq
MIRT1477456	hsa-miR-4773	CLIP-seq
MIRT2143789	hsa-miR-4784	CLIP-seq
MIRT2143790	hsa-miR-612	CLIP-seq
MIRT2143791	hsa-miR-762	CLIP-seq
MIRT2143773	hsa-miR-1285	CLIP-seq
MIRT1477417	hsa-miR-1287	CLIP-seq
MIRT1477418	hsa-miR-1321	CLIP-seq
MIRT2143774	hsa-miR-1587	CLIP-seq
MIRT2364050	hsa-miR-185	CLIP-seq
MIRT2364051	hsa-miR-1908	CLIP-seq
MIRT2364052	hsa-miR-2116	CLIP-seq
MIRT1477420	hsa-miR-2467-3p	CLIP-seq
MIRT1477421	hsa-miR-298	CLIP-seq
MIRT1477422	hsa-miR-3119	CLIP-seq
MIRT2364053	hsa-miR-3124-3p	CLIP-seq
MIRT1477423	hsa-miR-3135b	CLIP-seq
MIRT2143776	hsa-miR-3150b-3p	CLIP-seq
MIRT1477426	hsa-miR-3158-3p	CLIP-seq
MIRT2364054	hsa-miR-3178	CLIP-seq
MIRT1477428	hsa-miR-3180	CLIP-seq
MIRT1477429	hsa-miR-3180-3p	CLIP-seq
MIRT2143777	hsa-miR-3187-5p	CLIP-seq
MIRT1477430	hsa-miR-3196	CLIP-seq
MIRT1477431	hsa-miR-3202	CLIP-seq
MIRT2143778	hsa-miR-326	CLIP-seq
MIRT1477432	hsa-miR-329	CLIP-seq
MIRT2143779	hsa-miR-330-5p	CLIP-seq
MIRT1477433	hsa-miR-362-3p	CLIP-seq
MIRT1477434	hsa-miR-3678-3p	CLIP-seq
MIRT2143780	hsa-miR-378g	CLIP-seq
MIRT1477437	hsa-miR-3918	CLIP-seq
MIRT1477438	hsa-miR-3937	CLIP-seq
MIRT1477439	hsa-miR-3941	CLIP-seq
MIRT2364055	hsa-miR-4266	CLIP-seq
MIRT2364056	hsa-miR-4306	CLIP-seq
MIRT2143781	hsa-miR-4486	CLIP-seq
MIRT2143782	hsa-miR-4492	CLIP-seq
MIRT2143783	hsa-miR-4498	CLIP-seq
MIRT1477444	hsa-miR-4512	CLIP-seq
MIRT2364057	hsa-miR-4532	CLIP-seq
MIRT1477445	hsa-miR-4533	CLIP-seq
MIRT2364058	hsa-miR-4644	CLIP-seq
MIRT2143784	hsa-miR-4656	CLIP-seq
MIRT2143785	hsa-miR-4675	CLIP-seq
MIRT2364059	hsa-miR-4677-5p	CLIP-seq
MIRT2143786	hsa-miR-4689	CLIP-seq
MIRT2364060	hsa-miR-4695-5p	CLIP-seq
MIRT1477448	hsa-miR-4721	CLIP-seq
MIRT1477449	hsa-miR-4728-5p	CLIP-seq
MIRT1477451	hsa-miR-4739	CLIP-seq
MIRT2143787	hsa-miR-4741	CLIP-seq
MIRT2143788	hsa-miR-4747-5p	CLIP-seq
MIRT1477452	hsa-miR-4756-5p	CLIP-seq
MIRT1477454	hsa-miR-4768-3p	CLIP-seq
MIRT1477456	hsa-miR-4773	CLIP-seq
MIRT2364061	hsa-miR-4779	CLIP-seq
MIRT1477457	hsa-miR-4781-5p	CLIP-seq
MIRT2143789	hsa-miR-4784	CLIP-seq
MIRT1477458	hsa-miR-4789-5p	CLIP-seq
MIRT1477461	hsa-miR-603	CLIP-seq
MIRT2143790	hsa-miR-612	CLIP-seq
MIRT2364062	hsa-miR-663	CLIP-seq
MIRT1477463	hsa-miR-744	CLIP-seq
MIRT2143791	hsa-miR-762	CLIP-seq
MIRT2364063	hsa-miR-765	CLIP-seq
MIRT1477464	hsa-miR-922	CLIP-seq
MIRT1477421	hsa-miR-298	CLIP-seq
MIRT1477432	hsa-miR-329	CLIP-seq
MIRT1477433	hsa-miR-362-3p	CLIP-seq
MIRT1477437	hsa-miR-3918	CLIP-seq
MIRT1477439	hsa-miR-3941	CLIP-seq
MIRT1477444	hsa-miR-4512	CLIP-seq
MIRT1477454	hsa-miR-4768-3p	CLIP-seq
MIRT1477456	hsa-miR-4773	CLIP-seq
MIRT1477458	hsa-miR-4789-5p	CLIP-seq
MIRT1477461	hsa-miR-603	CLIP-seq
MIRT1477464	hsa-miR-922	CLIP-seq
MIRT2657812	hsa-miR-1254	CLIP-seq
MIRT2364050	hsa-miR-185	CLIP-seq
MIRT2364051	hsa-miR-1908	CLIP-seq
MIRT2364052	hsa-miR-2116	CLIP-seq
MIRT2657813	hsa-miR-3116	CLIP-seq
MIRT2364053	hsa-miR-3124-3p	CLIP-seq
MIRT2143776	hsa-miR-3150b-3p	CLIP-seq
MIRT2364054	hsa-miR-3178	CLIP-seq
MIRT1477428	hsa-miR-3180	CLIP-seq
MIRT1477429	hsa-miR-3180-3p	CLIP-seq
MIRT1477430	hsa-miR-3196	CLIP-seq
MIRT1477438	hsa-miR-3937	CLIP-seq
MIRT2364055	hsa-miR-4266	CLIP-seq
MIRT2364056	hsa-miR-4306	CLIP-seq
MIRT2364057	hsa-miR-4532	CLIP-seq
MIRT2364058	hsa-miR-4644	CLIP-seq
MIRT2364059	hsa-miR-4677-5p	CLIP-seq
MIRT2364060	hsa-miR-4695-5p	CLIP-seq
MIRT1477454	hsa-miR-4768-3p	CLIP-seq
MIRT1477456	hsa-miR-4773	CLIP-seq
MIRT2364061	hsa-miR-4779	CLIP-seq
MIRT1477457	hsa-miR-4781-5p	CLIP-seq
MIRT2143789	hsa-miR-4784	CLIP-seq
MIRT2657814	hsa-miR-596	CLIP-seq
MIRT2657815	hsa-miR-661	CLIP-seq
MIRT2364062	hsa-miR-663	CLIP-seq
MIRT1477463	hsa-miR-744	CLIP-seq
MIRT2364063	hsa-miR-765	CLIP-seq
MIRT2364050	hsa-miR-185	CLIP-seq
MIRT2364051	hsa-miR-1908	CLIP-seq
MIRT2364052	hsa-miR-2116	CLIP-seq
MIRT2364053	hsa-miR-3124-3p	CLIP-seq
MIRT2143776	hsa-miR-3150b-3p	CLIP-seq
MIRT2364054	hsa-miR-3178	CLIP-seq
MIRT1477438	hsa-miR-3937	CLIP-seq
MIRT2364055	hsa-miR-4266	CLIP-seq
MIRT2364056	hsa-miR-4306	CLIP-seq
MIRT2364057	hsa-miR-4532	CLIP-seq
MIRT2364058	hsa-miR-4644	CLIP-seq
MIRT2364059	hsa-miR-4677-5p	CLIP-seq
MIRT2364060	hsa-miR-4695-5p	CLIP-seq
MIRT1477454	hsa-miR-4768-3p	CLIP-seq
MIRT1477456	hsa-miR-4773	CLIP-seq
MIRT2364061	hsa-miR-4779	CLIP-seq
MIRT2143789	hsa-miR-4784	CLIP-seq
MIRT2657814	hsa-miR-596	CLIP-seq
MIRT2364062	hsa-miR-663	CLIP-seq
MIRT1477463	hsa-miR-744	CLIP-seq
MIRT2364063	hsa-miR-765	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001222	Function	Transcription corepressor binding	IPI	29628311
GO:0004197	Function	Cysteine-type endopeptidase activity	IDA	28992046
GO:0004197	Function	Cysteine-type endopeptidase activity	TAS	9827704
GO:0004843	Function	Cysteine-type deubiquitinase activity	IDA	15314155
GO:0004843	Function	Cysteine-type deubiquitinase activity	IEA
GO:0004843	Function	Cysteine-type deubiquitinase activity	TAS	8845848
GO:0005515	Function	Protein binding	IPI	15314155, 18408009, 20601937, 20924359, 22190034, 29293652, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	28992046
GO:0005634	Component	Nucleus	IDA	15314155
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0016579	Process	Protein deubiquitination	IDA	15314155
GO:0016579	Process	Protein deubiquitination	IEA
GO:0016579	Process	Protein deubiquitination	TAS
GO:0016787	Function	Hydrolase activity	IEA

MIM	HGNC	e!Ensembl
300050	12609	ENSG00000102226

P51784

Protein name

Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.4.19.12) (Deubiquitinating enzyme 11) (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11)

Protein function

Protease that can remove conjugated ubiquitin from target proteins and polyubiquitin chains (PubMed:12084015, PubMed:15314155, PubMed:17897950, PubMed:19874889, PubMed:20233726, PubMed:24724799, PubMed:28992046). Inhibits the degradation of targ

PDB

4MEL , 5OK6 , 8OYP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06337	DUSP	99 → 185	DUSP domain	Domain
PF14836	Ubiquitin_3	198 → 285	Ubiquitin-like domain	Domain
PF00443	UCH	309 → 927	Ubiquitin carboxyl-terminal hydrolase	Family
PF14533	USP7_C2	481 → 615	Ubiquitin-specific protease C-terminal	Family

Sequence

MAVAPRLFGGLCFRFRDQNPEVAVEGRLPISHSCVGCRRERTAMATVAANPAAAAAAVAA
AAAVTEDREPQHEELPGLDSQWRQIENGESGRERPLRAGESWFLVEKHWYKQWEAYVQGG
DQDSSTFPGCINNATLFQDEINWRLKEGLVEGEDYVLLPAAAWHYLVSWYGLEHGQPPIE
RKVIELPNIQKVEVYPVELLLVRHNDLGKSHTVQFSHTDSIGLVLRTARERFLVEPQEDT
RLWAKNSEGSLDRLYDTHITVLDAALETGQLIIMETRKKDGTWPSAQLHVMNNNMSEEDE
DFKGQPGICGLTNLGNTCFMNSALQCLSNVPQLTEYFLNNCYLEELNFRNPLGMKGEIAE
AYADLVKQAWSGHHRSIVPHVFKNKVGHFASQFLGYQQHDSQELLSFLLDGLHEDLNRVK
KKEYVELCDAAGRPDQEVAQEAWQNHKRRNDSVIVDTFHGLFKSTLVCPDCGNVSVTFDP
FCYLSVPLPISHKRVLEVFFIPMDPRRKPEQHRLVVPKKGKISDLCVALSKHTGISPERM
MVADVFSHRFYKLYQLEEPLSSILDRDDIFVYEVSGRIEAIEGSREDIVVPVYLRERTPA
RDYNNSYYGLMLFGHPLLVSVPRDRFTWEGLYNVLMYRLSRYVTKPNSDDEDDGDEKEDD
EEDKDDVPGPSTGGSLRDPEPEQAGPSSGVTNRCPFLLDNCLGTSQWPPRRRRKQLFTLQ
TVNSNGTSDRTTSPEEVHAQPYIAIDWEPEMKKRYYDEVEAEGYVKHDCVGYVMKKAPVR
LQECIELFTTVETLEKENPWYCPSCKQHQLATKKLDLWMLPEILIIHLKRFSYTKFSREK
LDTLVEFPIRDLDFSEFVIQPQNESNPELYKYDLIAVSNHYGGMRDGHYTTFACNKDSGQ
WHYFDDNSVSPVNENQIESKAAYVLFYQRQDVARRLLSPAGSSGAPASPACSSPPSSEFM
DVN

Sequence length

963

Interactions

View interactions

	Reactome
			Ub-specific processing proteases

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (5)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Abnormal brain morphology	Likely pathogenic	rs780096892	RCV000454353	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Abnormal ciliary motility	Likely pathogenic	rs777516785	RCV000785881	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Absent inner and outer dynein arms	Likely pathogenic	rs777516785	RCV000785881	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Bronchiectasis	Likely pathogenic	rs777516785	RCV000785881	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Dynein arm defect of respiratory motile cilia	Likely pathogenic	rs777516785	RCV000785881	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Melanoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
USP11-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (37)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Atherosclerosis	Atherosclerosis	Pubtator	37287426	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	24487962	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	29035352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28040451, 29724812, 30569152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23337751, 28040451, 29724812	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	CLINVAR_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Calcinosis	Calcinosis	Pubtator	35055037	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28040451, 34114341	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34114341	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	23696131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	30569152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31521612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32364424, 33685455, 37414755	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	29483509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	9801870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	23696131		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	23696131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	34114341	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	24487962	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	9801870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	36490346	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29545598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	34114341	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28040451, 29724812, 30569152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	30569152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29035352, 29545598, 30569152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	28040451, 30569152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	9801870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29228550, 29545598, 30733438, 31521612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Night blindness, congenital stationary	Night blindness	BEFREE	9801870		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	30569152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	23696131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	9801870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	9801870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Situs inversus totalis	Situs Inversus	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	29228550		★★★★★ ★☆☆☆☆ Found in Text Mining only
XERODERMA PIGMENTOSUM, COMPLEMENTATION GROUP C	Xeroderma Pigmentosum	BEFREE	29228550		★★★★★ ★☆☆☆☆ Found in Text Mining only

USP11 (ubiquitin specific peptidase 11)