Gene Gene information from NCBI Gene database.
Entrez ID 8233
Gene name Zinc finger CCCH-type, RNA binding motif and serine/arginine rich 2
Gene symbol ZRSR2
Synonyms (NCBI Gene)
OFD21U2AF1-RS2U2AF1L2U2AF1RS2URPZC3H22
Chromosome X
Chromosome location Xp22.2
Summary This gene encodes an essential splicing factor. The encoded protein associates with the U2 auxiliary factor heterodimer, which is required for the recognition of a functional 3` splice site in pre-mRNA splicing, and may play a role in network interactions
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
23
GO ID Ontology Definition Evidence Reference
GO:0000245 Process Spliceosomal complex assembly IMP 21041408
GO:0000398 Process MRNA splicing, via spliceosome IBA
GO:0000398 Process MRNA splicing, via spliceosome IEA
GO:0000398 Process MRNA splicing, via spliceosome IMP 9237760
GO:0003676 Function Nucleic acid binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300028 23019 ENSG00000169249
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q15696
Protein name U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 2 (CCCH type zinc finger, RNA-binding motif and serine/arginine rich protein 2) (Renal carcinoma antigen NY-REN-20) (U2(RNU2) small nuclear RNA auxiliary factor 1-like 2) (
Protein function Pre-mRNA-binding protein required for splicing of both U2- and U12-type introns. Selectively interacts with the 3'-splice site of U2- and U12-type pre-mRNAs and promotes different steps in U2 and U12 intron splicing. Recruited to U12 pre-mRNAs i
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00642 zf-CCCH 167 193 Zinc finger C-x8-C-x5-C-x3-H type (and similar) Family
PF00076 RRM_1 240 298 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF00642 zf-CCCH 307 332 Zinc finger C-x8-C-x5-C-x3-H type (and similar) Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:9237760}.
Sequence
MAAPEKMTFPEKPSHKKYRAALKKEKRKKRRQELARLRDSGLSQKEEEEDTFIEEQQLEE
EKLLERERQRLHEEWLLREQKAQEEFRIKKEKEEAAKKRQEEQERKLKEQWEEQQRKERE
EEEQKRQEKKEKEEALQKMLDQAENELENGTTWQNPEPPVDFRVMEKDRANCPFYSKTGA
CRFGDRCSRKHNF
PTSSPTLLIKSMFTTFGMEQCRRDDYDPDASLEYSEEETYQQFLDFY
EDVLPEFKNVGKVIQFKVSCNLEPHLRGNVYVQYQSEEECQAALSLFNGRWYAGRQLQ
CE
FCPVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFWEANRDIYLSPDRTGSSFGKN
SERRERMGHHDDYYSRLRGRRNPSPDHSYKRNGESERKSSRHRGKKSHKRTSKSRERHNS
RSRGRNRDRSRDRSRGRGSRSRSRSRSRRSRRSRSQSSSRSRSRGRRRSGNRDRTVQSPK
SK
Sequence length 482
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    mRNA Splicing - Minor Pathway
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
9
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Heart, malformation of Likely pathogenic rs1933151965 RCV001257352
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Holoprosencephaly sequence Likely pathogenic rs1933151965 RCV001257352
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Median cleft lip and palate Likely pathogenic rs1933151965 RCV001257352
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Orofaciodigital syndrome 21 Likely pathogenic rs1933151965 RCV004771808
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CONGENITAL HEART DEFECTS Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
HOLOPROSENCEPHALY Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
MYELODYSPLASTIC SYNDROMES CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
OROFACIODIGITAL SYNDROME XXI HPO
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute leukemia Leukemia BEFREE 28942350
★☆☆☆☆
Found in Text Mining only
Anemia Macrocytic Macrocytic anemia Pubtator 35351745 Associate
★☆☆☆☆
Found in Text Mining only
Anemia, Macrocytic Anemia BEFREE 28942350
★☆☆☆☆
Found in Text Mining only
Arnold Chiari Malformation Arnold-Chiari malformation BEFREE 30621833
★☆☆☆☆
Found in Text Mining only
Behcet Syndrome Behcet disease Pubtator 35351745 Associate
★☆☆☆☆
Found in Text Mining only
Chronic Lymphocytic Leukemia Lymphocytic Leukemia CGI_DG
★☆☆☆☆
Found in Text Mining only
Disseminated Intravascular Coagulation Disseminated intravascular coagulation Pubtator 40066790 Associate
★☆☆☆☆
Found in Text Mining only
Hematoma Hematoma Pubtator 40066790 Associate
★☆☆☆☆
Found in Text Mining only
Hypergammaglobulinemia Hypergammaglobulinemia Pubtator 36445600 Associate
★☆☆☆☆
Found in Text Mining only
Juvenile Myelomonocytic Leukemia Myelomonocytic Leukemia CTD_human_DG 26457647
★☆☆☆☆
Found in Text Mining only