KIF18A (kinesin family member 18A)

Gene

• Entrez ID: 81930
• Gene name: Kinesin family member 18A
• Gene symbol: KIF18A
• Synonyms (NCBI Gene): MS-KIF18A, PPP1R99
• Chromosome: 11
• Chromosome location: 11p14.1
• Summary: KIF18A is a member of the kinesin superfamily of microtubule-associated molecular motors (see MIM 148760) that use hydrolysis of ATP to produce force and movement along microtubules (Luboshits and Benayahu, 2005 [PubMed 15878648]).[supplied by OMIM, Aug 2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT024821	hsa-miR-215-5p	Microarray	19074876
MIRT026687	hsa-miR-192-5p	Microarray	19074876
MIRT1093465	hsa-miR-3115	CLIP-seq
MIRT1093466	hsa-miR-323-3p	CLIP-seq
MIRT1093467	hsa-miR-4699-3p	CLIP-seq
MIRT1093468	hsa-miR-4773	CLIP-seq
MIRT1093469	hsa-miR-548a-5p	CLIP-seq
MIRT1093470	hsa-miR-548ab	CLIP-seq
MIRT1093471	hsa-miR-548ak	CLIP-seq
MIRT1093472	hsa-miR-548b-5p	CLIP-seq
MIRT1093473	hsa-miR-548c-5p	CLIP-seq
MIRT1093474	hsa-miR-548d-5p	CLIP-seq
MIRT1093475	hsa-miR-548h	CLIP-seq
MIRT1093476	hsa-miR-548i	CLIP-seq
MIRT1093477	hsa-miR-548j	CLIP-seq
MIRT1093478	hsa-miR-548k	CLIP-seq
MIRT1093479	hsa-miR-548l	CLIP-seq
MIRT1093480	hsa-miR-548w	CLIP-seq
MIRT1093481	hsa-miR-548y	CLIP-seq
MIRT1093482	hsa-miR-559	CLIP-seq
MIRT1093483	hsa-miR-570	CLIP-seq
MIRT2025073	hsa-miR-758	CLIP-seq
MIRT2256167	hsa-miR-4327	CLIP-seq
MIRT2256168	hsa-miR-4766-5p	CLIP-seq
MIRT2256169	hsa-miR-544	CLIP-seq
MIRT1093478	hsa-miR-548k	CLIP-seq
MIRT2256170	hsa-miR-628-5p	CLIP-seq
MIRT2256171	hsa-miR-890	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000070	Process	Mitotic sister chromatid segregation	IBA
GO:0000166	Function	Nucleotide binding	IEA
GO:0000278	Process	Mitotic cell cycle	IEA
GO:0000776	Component	Kinetochore	IEA
GO:0001726	Component	Ruffle	IDA	17006958
GO:0001726	Component	Ruffle	IEA
GO:0003774	Function	Cytoskeletal motor activity	IEA
GO:0003777	Function	Microtubule motor activity	IEA
GO:0003779	Function	Actin binding	IPI	18680169
GO:0005515	Function	Protein binding	IPI	15231748, 17006958, 23288039, 27173435, 28514442, 33961781, 35271311
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	17006958, 17346968, 18680169
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	17006958, 18680169
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IEA
GO:0005828	Component	Kinetochore microtubule	IDA	17346968
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005871	Component	Kinesin complex	IBA
GO:0005874	Component	Microtubule	IEA
GO:0005876	Component	Spindle microtubule	IEA
GO:0005901	Component	Caveola	IDA	17006958
GO:0007018	Process	Microtubule-based movement	IBA
GO:0007018	Process	Microtubule-based movement	IEA
GO:0007019	Process	Microtubule depolymerization	IBA
GO:0007019	Process	Microtubule depolymerization	IDA	17346968
GO:0007019	Process	Microtubule depolymerization	IEA
GO:0007080	Process	Mitotic metaphase chromosome alignment	IDA	17346968
GO:0007080	Process	Mitotic metaphase chromosome alignment	IEA
GO:0007140	Process	Male meiotic nuclear division	IEA
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IDA	18680169
GO:0008017	Function	Microtubule binding	IEA
GO:0008574	Function	Plus-end-directed microtubule motor activity	IBA
GO:0008574	Function	Plus-end-directed microtubule motor activity	IDA	17346968
GO:0015031	Process	Protein transport	IEA
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0016887	Function	ATP hydrolysis activity	IBA
GO:0042995	Component	Cell projection	IEA
GO:0051010	Function	Microtubule plus-end binding	IDA	17346968
GO:0061673	Component	Mitotic spindle astral microtubule	IBA
GO:0070463	Function	Tubulin-dependent ATPase activity	IDA	17346968
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	IEA
GO:0071392	Process	Cellular response to estradiol stimulus	IEA
GO:0072520	Process	Seminiferous tubule development	IEA
GO:1990023	Component	Mitotic spindle midzone	IBA
GO:1990023	Component	Mitotic spindle midzone	IEA

Other IDs

• MIM: 611271
• HGNC: 29441
• e!Ensembl: ENSG00000121621

Protein

• UniProt ID: Q8NI77
• Protein name: Kinesin-like protein KIF18A (Marrow stromal KIF18A) (MS-KIF18A)
• Protein function: Microtubule-depolymerizing kinesin which plays a role in chromosome congression by reducing the amplitude of preanaphase oscillations and slowing poleward movement during anaphase, thus suppressing chromosome movements. May stabilize the CENPE-B
• PDB: 3LRE, 5OAM, 5OCU, 5OGC, 7RSI
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00225	Kinesin	17 → 355	Kinesin motor domain	Domain

• Sequence:

  MSVTEEDLCHHMKVVVRVRPENTKEKAAGFHKVVHVVDKHILVFDPKQEEVSFFHGKKTT
  NQNVIKKQNKDLKFVFDAVFDETSTQSEVFEHTTKPILRSFLNGYNCTVLAYGATGAGKT
  HTMLGSADEPGVMYLTMLHLYKCMDEIKEEKICSTAVSYLEVYNEQIRDLLVNSGPLAVR
  EDTQKGVVVHGLTLHQPKSSEEILHLLDNGNKNRTQHPTDMNATSSRSHAVFQIYLRQQD
  KTASINQNVRIAKMSLIDLAGSERASTSGAKGTRFVEGTNINRSLLALGNVINALADSKR
  KNQHIPYRNSKLTRLLKDSLGGNCQTIMIAAVSPSSVFYDDTYNTLKYANRAKDIKSSLK
  SNVLNVNNHITQYVKICNEQKAEILLLKEKLKAYEEQKAFTNENDQAKLMISNPQEKEIE
  RFQEILNCLFQNREEIRQEYLKLEMLLKENELKSFYQQQCHKQIEMMCSEDKVEKATGKR
  DHRLAMLKTRRSYLEKRREEELKQFDENTNWLHRVEKEMGLLSQNGHIPKELKKDLHCHH
  LHLQNKDLKAQIRHMMDLACLQEQQHRQTEAVLNALLPTLRKQYCTLKEAGLSNAAFESD
  FKEIEHLVERKKVVVWADQTAEQPKQNDLPGISVLMTFPQLGPVQPIPCCSSSGGTNLVK
  IPTEKRTRRKLMPSPLKGQHTLKSPPSQSVQLNDSLSKELQPIVYTPEDCRKAFQNPSTV
  TLMKPSSFTTSFQAISSNINSDNCLKMLCEVAIPHNRRKECGQEDLDSTFTICEDIKSSK
  CKLPEQESLPNDNKDILQRLDPSSFSTKHSMPVPSMVPSYMAMTTAAKRKRKLTSSTSNS
  SLTADVNSGFAKRVRQDNSSEKHLQENKPTMEHKRNICKINPSMVRKFGRNISKGNLR

• Sequence length: 898

Pathways

KEGG:

Motor proteins

Reactome:

Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
MHC class II antigen presentation
Separation of Sister Chromatids
Resolution of Sister Chromatid Cohesion
RHO GTPases Activate Formins
COPI-dependent Golgi-to-ER retrograde traffic
Mitotic Prometaphase
EML4 and NUDC in mitotic spindle formation
Kinesins

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANNABIS DEPENDENCE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30817091, 30907518, 31772692		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	32923148, 36830695	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20595236, 30306428		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30907518, 30961553, 33066779, 33619254, 38195458	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	30907518	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25431949, 33111935, 36204642, 40255404	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	30822312, 31948514, 36830695	Associate	★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	33619254	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21213216		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33619254	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36830695	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	33872988	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30872592	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	36830695	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	38195458	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	33626918	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25431949, 29466986, 31392101		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25431949	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	30907518	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31977917	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20595236, 30306428		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29466986		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31451680		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20595236, 30306428		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	28404951		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	28404951	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20595236, 21213216, 25431949, 29466986, 30907518, 31451680, 31772692		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	30306428		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	36830695	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31451680		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31451680	Associate	★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	31977917	Stimulate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	25431949	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33829064	Associate	★☆☆☆☆ Found in Text Mining only