SLIRP (SRA stem-loop interacting RNA binding protein)

Gene

• Entrez ID: 81892
• Gene name: SRA stem-loop interacting RNA binding protein
• Gene symbol: SLIRP
• Synonyms (NCBI Gene): C14orf156, DC50, PD04872
• Chromosome: 14
• Chromosome location: 14q24.3
• Summary: Steroid receptor RNA activator (SRA, or SRA1; MIM 603819) is a complex RNA molecule containing multiple stable stem-loop structures that functions in coactivation of nuclear receptors. SLIRP interacts with stem-loop structure-7 of SRA (STR7) and modulates

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT031680	hsa-miR-16-5p	Proteomics	18668040
MIRT035796	hsa-miR-1914-5p	CLASH	23622248
MIRT1369694	hsa-miR-3929	CLIP-seq
MIRT1369695	hsa-miR-4264	CLIP-seq
MIRT1369696	hsa-miR-4419b	CLIP-seq
MIRT1369697	hsa-miR-4477a	CLIP-seq
MIRT1369698	hsa-miR-4478	CLIP-seq
MIRT1369699	hsa-miR-4797-3p	CLIP-seq
MIRT1369700	hsa-miR-633	CLIP-seq
MIRT1369701	hsa-miR-935	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000961	Process	Negative regulation of mitochondrial RNA catabolic process	IEA
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IEA
GO:0003729	Function	MRNA binding	IDA	22661577
GO:0005515	Function	Protein binding	IPI	22045337, 25416956, 26496610, 28892042, 29507755, 32296183, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IDA	23275553
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0007005	Process	Mitochondrion organization	IEA
GO:0007286	Process	Spermatid development	IEA
GO:0007338	Process	Single fertilization	IEA
GO:0030317	Process	Flagellated sperm motility	IEA
GO:0036126	Component	Sperm flagellum	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0097222	Process	Mitochondrial mRNA polyadenylation	IMP	22661577
GO:1905638	Process	Negative regulation of mitochondrial mRNA catabolic process	IMP	22661577
GO:1990904	Component	Ribonucleoprotein complex	IEA

Other IDs

• MIM: 610211
• HGNC: 20495
• e!Ensembl: ENSG00000119705

Protein

• UniProt ID: Q9GZT3
• Protein name: SRA stem-loop-interacting RNA-binding protein, mitochondrial
• Protein function: RNA-binding protein that acts as a nuclear receptor corepressor. Probably acts by binding the SRA RNA, and repressing the SRA-mediated nuclear receptor coactivation. Binds the STR7 loop of SRA RNA. Also able to repress glucocorticoid (GR), andro
• PDB: 8ANY
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00076	RRM_1	21 → 89	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed, with highest level in heart, liver, skeletal muscle and testis. {ECO:0000269|PubMed:16762838}.
• Sequence:

  MAASAARGAAALRRSINQPVAFVRRIPWTAASSQLKEHFAQFGHVRRCILPFDKETGFHR
  GLGWVQFSSEEGLRNALQQENHIIDGVKVQVHTRRPKLPQTSDDEKKDF

• Sequence length: 109

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Colorectal cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL ENCEPHALOMYOPATHIES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitochondrial encephalomyopathy	-	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Uterine carcinosarcoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Chronic Disease	Chronic disease	Pubtator	37249456	Associate	★☆☆☆☆ Found in Text Mining only
Cytochrome c Oxidase Deficiency	Cytochrome c oxidase deficiency	Pubtator	34426662	Associate	★☆☆☆☆ Found in Text Mining only
Leigh syndrome , French Canadian type	Leigh syndrome	BEFREE	25214534		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	34426662	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Encephalomyopathies	Mitochondrial encephalomyopathy	Pubtator	34426662	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	16762838		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	37249456	Associate	★☆☆☆☆ Found in Text Mining only