Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	81832
Gene name	Neuropilin and tolloid like 1
Gene symbol	NETO1
Synonyms (NCBI Gene)	BCTL1BTCL1
Chromosome	18
Chromosome location	18q22.3
Summary	This gene encodes a transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. This protein is thought to play a critical role in spatial learning and memory by regulating the function of sy

Show/Hide all (71)

miRTarBase ID	miRNA	Experiments	Reference
MIRT535698	hsa-miR-3938	PAR-CLIP	22012620
MIRT535697	hsa-miR-6826-3p	PAR-CLIP	22012620
MIRT443524	hsa-miR-497-3p	PAR-CLIP	22100165
MIRT443523	hsa-miR-5692a	PAR-CLIP	22100165
MIRT535698	hsa-miR-3938	PAR-CLIP	22012620
MIRT535697	hsa-miR-6826-3p	PAR-CLIP	22012620
MIRT443524	hsa-miR-497-3p	PAR-CLIP	22100165
MIRT443523	hsa-miR-5692a	PAR-CLIP	22100165
MIRT1180822	hsa-miR-1	CLIP-seq
MIRT1180823	hsa-miR-1261	CLIP-seq
MIRT1180824	hsa-miR-1273e	CLIP-seq
MIRT1180825	hsa-miR-1290	CLIP-seq
MIRT1180826	hsa-miR-206	CLIP-seq
MIRT1180827	hsa-miR-219-2-3p	CLIP-seq
MIRT1180828	hsa-miR-23a	CLIP-seq
MIRT1180829	hsa-miR-23b	CLIP-seq
MIRT1180830	hsa-miR-23c	CLIP-seq
MIRT1180831	hsa-miR-2682	CLIP-seq
MIRT1180832	hsa-miR-2964a-3p	CLIP-seq
MIRT1180833	hsa-miR-3163	CLIP-seq
MIRT1180834	hsa-miR-34a	CLIP-seq
MIRT1180835	hsa-miR-34c-5p	CLIP-seq
MIRT1180836	hsa-miR-3613-3p	CLIP-seq
MIRT1180837	hsa-miR-3668	CLIP-seq
MIRT1180838	hsa-miR-3673	CLIP-seq
MIRT1180839	hsa-miR-3714	CLIP-seq
MIRT1180840	hsa-miR-377	CLIP-seq
MIRT1180841	hsa-miR-3908	CLIP-seq
MIRT1180842	hsa-miR-3914	CLIP-seq
MIRT1180843	hsa-miR-4452	CLIP-seq
MIRT1180844	hsa-miR-4477a	CLIP-seq
MIRT1180845	hsa-miR-4484	CLIP-seq
MIRT1180846	hsa-miR-449a	CLIP-seq
MIRT1180847	hsa-miR-449b	CLIP-seq
MIRT1180848	hsa-miR-449c	CLIP-seq
MIRT1180849	hsa-miR-487a	CLIP-seq
MIRT1180850	hsa-miR-5096	CLIP-seq
MIRT1180851	hsa-miR-518a-5p	CLIP-seq
MIRT1180852	hsa-miR-527	CLIP-seq
MIRT1180853	hsa-miR-548a-3p	CLIP-seq
MIRT1180854	hsa-miR-548an	CLIP-seq
MIRT1180855	hsa-miR-548e	CLIP-seq
MIRT1180856	hsa-miR-548f	CLIP-seq
MIRT1180857	hsa-miR-568	CLIP-seq
MIRT1180858	hsa-miR-596	CLIP-seq
MIRT1180859	hsa-miR-613	CLIP-seq
MIRT1180860	hsa-miR-3120-3p	CLIP-seq
MIRT1180861	hsa-miR-579	CLIP-seq
MIRT1556726	hsa-miR-4755-3p	CLIP-seq
MIRT1556727	hsa-miR-4768-3p	CLIP-seq
MIRT1556728	hsa-miR-665	CLIP-seq
MIRT2052293	hsa-miR-34b	CLIP-seq
MIRT1180836	hsa-miR-3613-3p	CLIP-seq
MIRT2052294	hsa-miR-3614-5p	CLIP-seq
MIRT2052295	hsa-miR-4328	CLIP-seq
MIRT2052296	hsa-miR-4435	CLIP-seq
MIRT1180843	hsa-miR-4452	CLIP-seq
MIRT2052297	hsa-miR-4639-3p	CLIP-seq
MIRT2052298	hsa-miR-4694-3p	CLIP-seq
MIRT2052299	hsa-miR-617	CLIP-seq
MIRT2052300	hsa-miR-7	CLIP-seq
MIRT2281706	hsa-miR-3919	CLIP-seq
MIRT2281707	hsa-miR-4436b-5p	CLIP-seq
MIRT1180850	hsa-miR-5096	CLIP-seq
MIRT2281708	hsa-miR-513b	CLIP-seq
MIRT2579902	hsa-miR-3591-3p	CLIP-seq
MIRT2579903	hsa-miR-548aa	CLIP-seq
MIRT2579904	hsa-miR-548ac	CLIP-seq
MIRT2579905	hsa-miR-548d-3p	CLIP-seq
MIRT2579906	hsa-miR-548z	CLIP-seq
MIRT2579907	hsa-miR-634	CLIP-seq

Show/Hide all (29)

GO ID	Ontology	Definition	Evidence
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0007613	Process	Memory	IEA
GO:0007613	Process	Memory	ISS
GO:0008542	Process	Visual learning	IEA
GO:0008542	Process	Visual learning	ISS
GO:0014069	Component	Postsynaptic density	IBA
GO:0014069	Component	Postsynaptic density	IEA
GO:0014069	Component	Postsynaptic density	ISS
GO:0016020	Component	Membrane	IEA
GO:0035255	Function	Ionotropic glutamate receptor binding	IBA
GO:0035255	Function	Ionotropic glutamate receptor binding	IEA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0048169	Process	Regulation of long-term neuronal synaptic plasticity	IEA
GO:0048169	Process	Regulation of long-term neuronal synaptic plasticity	ISS
GO:0060076	Component	Excitatory synapse	IEA
GO:0060076	Component	Excitatory synapse	ISS
GO:0097120	Process	Receptor localization to synapse	IEA
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098839	Component	Postsynaptic density membrane	IEA
GO:0098839	Component	Postsynaptic density membrane	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099645	Process	Neurotransmitter receptor localization to postsynaptic specialization membrane	IEA
GO:0140231	Process	Anterograde axonal transport of neurotransmitter receptor complex	IEA
GO:1904115	Component	Axon cytoplasm	IEA
GO:2000463	Process	Positive regulation of excitatory postsynaptic potential	IBA
GO:2000463	Process	Positive regulation of excitatory postsynaptic potential	IEA

MIM	HGNC	e!Ensembl
607973	13823	ENSG00000166342

Q8TDF5

Protein name

Neuropilin and tolloid-like protein 1 (Brain-specific transmembrane protein containing 2 CUB and 1 LDL-receptor class A domains protein 1)

Protein function

Involved in the development and/or maintenance of neuronal circuitry. Accessory subunit of the neuronal N-methyl-D-aspartate receptor (NMDAR) critical for maintaining the abundance of GRIN2A-containing NMDARs in the postsynaptic density. Regulat

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00431	CUB	41 → 152	CUB domain	Domain
PF00431	CUB	172 → 284	CUB domain	Domain
PF00057	Ldl_recept_a	290 → 326	Low-density lipoprotein receptor domain class A	Repeat

Tissue specificity

TISSUE SPECIFICITY: Isoform 1 and isoform 2 are retina-specific. Isoform 3 is found in retina as well as at lower levels in adult and fetal brain. {ECO:0000269|PubMed:11943477}.

Sequence

MIHGRSVLHIVASLIILHLSGATKKGTEKQTTSETQKSVQCGTWTKHAEGGIFTSPNYPS
KYPPDRECIYIIEAAPRQCIELYFDEKYSIEPSWECKFDHIEVRDGPFGFSPIIGRFCGQ
QNPPVIKSSGRFLWIKFFADGELESMGFSARYNFTPDPDFKDLGALKPLPACEFEMGGSE
GIVESIQIMKEGKATASEAVDCKWYIRAPPRSKIYLRFLDYEMQNSNECKRNFVAVYDGS
SSVEDLKAKFCSTVANDVMLRTGLGVIRMWADEGSRNSRFQMLFTSFQEPPCEGNTFFCH
SNMCINNTLVCNGLQNCVYPWDENHCKEKRKTSLLDQLTNTSGTVIGVTSCIVIILIIIS
VIVQIKQPRKKYVQRKSDFDQTVFQEVFEPPHYELCTLRGTGATADFADVADDFENYHKL
RRSSSKCIHDHHCGSQLSSTKGSRSNLSTRDASILTEMPTQPGKPLIPPMNRRNILVMKH
SYSQDAADACDIDEIEEVPTTSHRLSRHDKAVQRFCLIGSLSKHESEYNTTRV

Sequence length

533

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
EXOSTOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Autistic Disorder	Autism	BEFREE	20499253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	32638511	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	36622818	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21782286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	22205981		★★★★★ ★☆☆☆☆ Found in Text Mining only

NETO1 (neuropilin and tolloid like 1)