Gene Gene information from NCBI Gene database.
Entrez ID 81831
Gene name Neuropilin and tolloid like 2
Gene symbol NETO2
Synonyms (NCBI Gene)
BTCL2NEOT2
Chromosome 16
Chromosome location 16q12.1
Summary This gene encodes a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. A similar gene in rats encodes a protein that modulates glutamate signaling in the brain by regulatin
miRNA miRNA information provided by mirtarbase database.
290
miRTarBase ID miRNA Experiments Reference
MIRT002815 hsa-miR-1-3p Luciferase reporter assayMicroarray 15685193
MIRT020025 hsa-miR-375 Microarray 20215506
MIRT002815 hsa-miR-1-3p Microarray 18668037
MIRT002815 hsa-miR-1-3p Microarray 15685193
MIRT030591 hsa-miR-24-3p Microarray 19748357
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32814053
GO:0014069 Component Postsynaptic density IBA
GO:0014069 Component Postsynaptic density IEA
GO:0016020 Component Membrane IEA
GO:0035255 Function Ionotropic glutamate receptor binding IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607974 14644 ENSG00000171208
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NC67
Protein name Neuropilin and tolloid-like protein 2 (Brain-specific transmembrane protein containing 2 CUB and 1 LDL-receptor class A domains protein 2)
Protein function Accessory subunit of neuronal kainate-sensitive glutamate receptors, GRIK2 and GRIK3. Increases kainate-receptor channel activity, slowing the decay kinetics of the receptors, without affecting their expression at the cell surface, and increasin
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00431 CUB 45 156 CUB domain Domain
PF00431 CUB 177 289 CUB domain Domain
PF00057 Ldl_recept_a 295 331 Low-density lipoprotein receptor domain class A Repeat
Sequence
MALERLCSVLKVLLITVLVVEGIAVAQKTQDGQNIGIKHIPATQCGIWVRTSNGGHFASP
NYPDSYPPNKECIYILEAAPRQRIELTFDEHYYIEPSFECRFDHLEVRDGPFGFSPLIDR
YCGVKSPPLIRSTGRFMWIKFSSDEELEGLGFRAKY
SFIPDPDFTYLGGILNPIPDCQFE
LSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKATPKAKIYLRFLDYQMEHSNECKRNFVA
VYDGSSSIENLKAKFCSTVANDVMLKTGIGVIRMWADEGSRLSRFRMLF
TSFVEPPCTSS
TFFCHSNMCINNSLVCNGVQNCAYPWDENHC
KEKKKAGVFEQITKTHGTIIGITSGIVLV
LLIISILVQVKQPRKKVMACKTAFNKTGFQEVFDPPHYELFSLRDKEISADLADLSEELD
NYQKMRRSSTASRCIHDHHCGSQASSVKQSRTNLSSMELPFRNDFAQPQPMKTFNSTFKK
SSYTFKQGHECPEQALEDRVMEEIPCEIYVRGREDSAQASISIDF
Sequence length 525
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CARCINOMA, ADENOID CYSTIC CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Prostate cancer Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
SALIVARY GLAND NEOPLASMS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenoid Cystic Carcinoma Adenocarcinoma CTD_human_DG 16762588
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 33390848 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Carcinoma BEFREE 30770791
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 40158169 Associate
★☆☆☆☆
Found in Text Mining only
Colorectal Carcinoma Colorectal Cancer BEFREE 29297384
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 26699544, 29297384 Stimulate
★☆☆☆☆
Found in Text Mining only
Esophageal Neoplasms Esophageal neoplasm Pubtator 33390848 Associate
★☆☆☆☆
Found in Text Mining only
Esophageal Squamous Cell Carcinoma Esophageal squamous cell carcinoma Pubtator 33006432, 33390848 Associate
★☆☆☆☆
Found in Text Mining only
Glioma Glioma Pubtator 36639372 Associate
★☆☆☆☆
Found in Text Mining only
Lymphatic Metastasis Lymphatic metastasis Pubtator 26699544, 30770791 Stimulate
★☆☆☆☆
Found in Text Mining only