OR12D3 (olfactory receptor family 12 subfamily D member 3)

Gene

• Entrez ID: 81797
• Gene name: Olfactory receptor family 12 subfamily D member 3
• Gene symbol: OR12D3
• Synonyms (NCBI Gene): hs6M1-27
• Chromosome: 6
• Chromosome location: 6p22.1
• Summary: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from sing

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1204577	hsa-miR-1236	CLIP-seq
MIRT1204578	hsa-miR-2110	CLIP-seq
MIRT1204579	hsa-miR-219-5p	CLIP-seq
MIRT1204580	hsa-miR-3148	CLIP-seq
MIRT1204581	hsa-miR-320e	CLIP-seq
MIRT1204582	hsa-miR-4271	CLIP-seq
MIRT1204583	hsa-miR-4445	CLIP-seq
MIRT1204584	hsa-miR-4453	CLIP-seq
MIRT1204585	hsa-miR-4464	CLIP-seq
MIRT1204586	hsa-miR-4536	CLIP-seq
MIRT1204587	hsa-miR-4538	CLIP-seq
MIRT1204588	hsa-miR-4667-5p	CLIP-seq
MIRT1204589	hsa-miR-4668-5p	CLIP-seq
MIRT1204590	hsa-miR-4700-5p	CLIP-seq
MIRT1204591	hsa-miR-4725-3p	CLIP-seq
MIRT1204592	hsa-miR-4731-5p	CLIP-seq
MIRT1204593	hsa-miR-4748	CLIP-seq
MIRT1204594	hsa-miR-4753-3p	CLIP-seq
MIRT1204595	hsa-miR-4782-3p	CLIP-seq
MIRT1204596	hsa-miR-508-3p	CLIP-seq
MIRT2287152	hsa-miR-4282	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004984	Function	Olfactory receptor activity	IBA
GO:0004984	Function	Olfactory receptor activity	IEA
GO:0005549	Function	Odorant binding	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007608	Process	Sensory perception of smell	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0050911	Process	Detection of chemical stimulus involved in sensory perception of smell	IBA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q9UGF7
• Protein name: Olfactory receptor 12D3 (Hs6M1-27) (Olfactory receptor OR6-27)
• Protein function: Odorant receptor.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13853	7tm_4	29 → 307	Olfactory receptor	Family

• Sequence:

  MENVTTMNEFLLLGLTGVQELQPFFFGIFLIIYLINLIGNGSILVMVVLEPQLHSPMYFF
  LGNLSCLDISYSSVTLPKLLVNLVCSRRAISFLGCITQLHFFHFLGSTEAILLAIMAFDR
  FVAICNPLRYTVIMNPQVCILLAAAAWLISFFYALMHSVMTAHLSFCGSQKLNHFFYDVK
  PLLELACSDTLLNQWLLSIVTGSISMGAFFLTLLSCFYVIGFLLFKNRSCRILHKALSTC
  ASHFMVVCLFYGPVGFTYIRPASATSMIQDRIMAIMYSAVTPVLNPLIYTLRNKEVMMAL
  KKIFGRKLFKDWQQHH

• Sequence length: 316

Pathways

KEGG:

Olfactory transduction

Reactome:

Olfactory Signaling Pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma Of Esophagus	Esophageal Cancer	GWASCAT_DG	27527254		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	GWASCAT_DG	25918132		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	GWASDB_DG	22961001		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	GWASCAT_DG	22961001, 27527254		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	29059683		★☆☆☆☆ Found in Text Mining only
Child Development Disorders, Pervasive	Development Disorder	GWASCAT_DG	28540026		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	GWASCAT_DG	31451708		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	GWASCAT_DG	31451708		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	17632545		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASDB_DG	24871463		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	29662059		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	GWASDB_DG	22899653		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	19503088		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	GWASCAT_DG	26651848		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	28540026, 30285260		★★☆☆☆ Found in Text Mining + Unknown/Other Associations