Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	81793
Gene name	Toll like receptor 10
Gene symbol	TLR10
Synonyms (NCBI Gene)	CD290
Chromosome	4
Chromosome location	4p14
Summary	The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and func

189

Show/Hide all (189)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049221	hsa-miR-92a-3p	CLASH	23622248
MIRT1426877	hsa-miR-1193	CLIP-seq
MIRT1426878	hsa-miR-122	CLIP-seq
MIRT1426879	hsa-miR-1226	CLIP-seq
MIRT1426880	hsa-miR-1273f	CLIP-seq
MIRT1426881	hsa-miR-1289	CLIP-seq
MIRT1426882	hsa-miR-143	CLIP-seq
MIRT1426883	hsa-miR-197	CLIP-seq
MIRT1426884	hsa-miR-2392	CLIP-seq
MIRT1426885	hsa-miR-3135b	CLIP-seq
MIRT1426886	hsa-miR-3149	CLIP-seq
MIRT1426887	hsa-miR-3163	CLIP-seq
MIRT1426888	hsa-miR-3187-3p	CLIP-seq
MIRT1426889	hsa-miR-3198	CLIP-seq
MIRT1426890	hsa-miR-340	CLIP-seq
MIRT1426891	hsa-miR-3652	CLIP-seq
MIRT1426892	hsa-miR-411	CLIP-seq
MIRT1426893	hsa-miR-4294	CLIP-seq
MIRT1426894	hsa-miR-4307	CLIP-seq
MIRT1426895	hsa-miR-4309	CLIP-seq
MIRT1426896	hsa-miR-4430	CLIP-seq
MIRT1426897	hsa-miR-4435	CLIP-seq
MIRT1426898	hsa-miR-4470	CLIP-seq
MIRT1426899	hsa-miR-450b-5p	CLIP-seq
MIRT1426900	hsa-miR-4534	CLIP-seq
MIRT1426901	hsa-miR-4695-3p	CLIP-seq
MIRT1426902	hsa-miR-4701-5p	CLIP-seq
MIRT1426903	hsa-miR-4708-5p	CLIP-seq
MIRT1426904	hsa-miR-4715-3p	CLIP-seq
MIRT1426905	hsa-miR-4716-5p	CLIP-seq
MIRT1426906	hsa-miR-4733-3p	CLIP-seq
MIRT1426907	hsa-miR-4770	CLIP-seq
MIRT1426908	hsa-miR-4772-3p	CLIP-seq
MIRT1426909	hsa-miR-4781-3p	CLIP-seq
MIRT1426910	hsa-miR-507	CLIP-seq
MIRT1426911	hsa-miR-5096	CLIP-seq
MIRT1426912	hsa-miR-548aa	CLIP-seq
MIRT1426913	hsa-miR-548ac	CLIP-seq
MIRT1426914	hsa-miR-548d-3p	CLIP-seq
MIRT1426915	hsa-miR-548s	CLIP-seq
MIRT1426916	hsa-miR-548z	CLIP-seq
MIRT1426917	hsa-miR-557	CLIP-seq
MIRT1426918	hsa-miR-587	CLIP-seq
MIRT1426919	hsa-miR-588	CLIP-seq
MIRT1426920	hsa-miR-720	CLIP-seq
MIRT1426921	hsa-miR-767-5p	CLIP-seq
MIRT1426922	hsa-miR-891b	CLIP-seq
MIRT1426923	hsa-miR-1185	CLIP-seq
MIRT1426878	hsa-miR-122	CLIP-seq
MIRT1426879	hsa-miR-1226	CLIP-seq
MIRT1426924	hsa-miR-1265	CLIP-seq
MIRT1426925	hsa-miR-2113	CLIP-seq
MIRT1426885	hsa-miR-3135b	CLIP-seq
MIRT1426888	hsa-miR-3187-3p	CLIP-seq
MIRT1426926	hsa-miR-3605-5p	CLIP-seq
MIRT1426891	hsa-miR-3652	CLIP-seq
MIRT1426927	hsa-miR-3679-5p	CLIP-seq
MIRT1426894	hsa-miR-4307	CLIP-seq
MIRT1426896	hsa-miR-4430	CLIP-seq
MIRT1426898	hsa-miR-4470	CLIP-seq
MIRT1426928	hsa-miR-4474-3p	CLIP-seq
MIRT1426899	hsa-miR-450b-5p	CLIP-seq
MIRT1426929	hsa-miR-4529-5p	CLIP-seq
MIRT1426901	hsa-miR-4695-3p	CLIP-seq
MIRT1426906	hsa-miR-4733-3p	CLIP-seq
MIRT1426910	hsa-miR-507	CLIP-seq
MIRT1426912	hsa-miR-548aa	CLIP-seq
MIRT1426913	hsa-miR-548ac	CLIP-seq
MIRT1426914	hsa-miR-548d-3p	CLIP-seq
MIRT1426916	hsa-miR-548z	CLIP-seq
MIRT1426917	hsa-miR-557	CLIP-seq
MIRT1426930	hsa-miR-663b	CLIP-seq
MIRT1426921	hsa-miR-767-5p	CLIP-seq
MIRT1426883	hsa-miR-197	CLIP-seq
MIRT1426884	hsa-miR-2392	CLIP-seq
MIRT1426886	hsa-miR-3149	CLIP-seq
MIRT1426888	hsa-miR-3187-3p	CLIP-seq
MIRT1426892	hsa-miR-411	CLIP-seq
MIRT1426897	hsa-miR-4435	CLIP-seq
MIRT1426898	hsa-miR-4470	CLIP-seq
MIRT1426899	hsa-miR-450b-5p	CLIP-seq
MIRT1426902	hsa-miR-4701-5p	CLIP-seq
MIRT1426905	hsa-miR-4716-5p	CLIP-seq
MIRT1426931	hsa-miR-4735-5p	CLIP-seq
MIRT1426932	hsa-miR-4775	CLIP-seq
MIRT1426909	hsa-miR-4781-3p	CLIP-seq
MIRT1426910	hsa-miR-507	CLIP-seq
MIRT1426911	hsa-miR-5096	CLIP-seq
MIRT1426912	hsa-miR-548aa	CLIP-seq
MIRT1426913	hsa-miR-548ac	CLIP-seq
MIRT1426914	hsa-miR-548d-3p	CLIP-seq
MIRT1426915	hsa-miR-548s	CLIP-seq
MIRT1426916	hsa-miR-548z	CLIP-seq
MIRT1426917	hsa-miR-557	CLIP-seq
MIRT1426919	hsa-miR-588	CLIP-seq
MIRT1426933	hsa-miR-590-3p	CLIP-seq
MIRT1426921	hsa-miR-767-5p	CLIP-seq
MIRT1920979	hsa-miR-150	CLIP-seq
MIRT1920980	hsa-miR-498	CLIP-seq
MIRT1426921	hsa-miR-767-5p	CLIP-seq
MIRT1920979	hsa-miR-150	CLIP-seq
MIRT1920980	hsa-miR-498	CLIP-seq
MIRT1426921	hsa-miR-767-5p	CLIP-seq
MIRT1920979	hsa-miR-150	CLIP-seq
MIRT1920980	hsa-miR-498	CLIP-seq
MIRT1426921	hsa-miR-767-5p	CLIP-seq
MIRT1920979	hsa-miR-150	CLIP-seq
MIRT1426883	hsa-miR-197	CLIP-seq
MIRT1426886	hsa-miR-3149	CLIP-seq
MIRT1426892	hsa-miR-411	CLIP-seq
MIRT1426905	hsa-miR-4716-5p	CLIP-seq
MIRT1426931	hsa-miR-4735-5p	CLIP-seq
MIRT1426932	hsa-miR-4775	CLIP-seq
MIRT1426909	hsa-miR-4781-3p	CLIP-seq
MIRT1920980	hsa-miR-498	CLIP-seq
MIRT1426911	hsa-miR-5096	CLIP-seq
MIRT1426933	hsa-miR-590-3p	CLIP-seq
MIRT1920979	hsa-miR-150	CLIP-seq
MIRT1426899	hsa-miR-450b-5p	CLIP-seq
MIRT1920980	hsa-miR-498	CLIP-seq
MIRT1426910	hsa-miR-507	CLIP-seq
MIRT1426912	hsa-miR-548aa	CLIP-seq
MIRT1426913	hsa-miR-548ac	CLIP-seq
MIRT1426914	hsa-miR-548d-3p	CLIP-seq
MIRT1426916	hsa-miR-548z	CLIP-seq
MIRT1426917	hsa-miR-557	CLIP-seq
MIRT1426921	hsa-miR-767-5p	CLIP-seq
MIRT1426878	hsa-miR-122	CLIP-seq
MIRT1426879	hsa-miR-1226	CLIP-seq
MIRT1426885	hsa-miR-3135b	CLIP-seq
MIRT1426891	hsa-miR-3652	CLIP-seq
MIRT1426896	hsa-miR-4430	CLIP-seq
MIRT1426901	hsa-miR-4695-3p	CLIP-seq
MIRT1426906	hsa-miR-4733-3p	CLIP-seq
MIRT1426883	hsa-miR-197	CLIP-seq
MIRT1426886	hsa-miR-3149	CLIP-seq
MIRT1426888	hsa-miR-3187-3p	CLIP-seq
MIRT1426892	hsa-miR-411	CLIP-seq
MIRT1426897	hsa-miR-4435	CLIP-seq
MIRT1426902	hsa-miR-4701-5p	CLIP-seq
MIRT1426905	hsa-miR-4716-5p	CLIP-seq
MIRT1426931	hsa-miR-4735-5p	CLIP-seq
MIRT1426932	hsa-miR-4775	CLIP-seq
MIRT1426909	hsa-miR-4781-3p	CLIP-seq
MIRT1426911	hsa-miR-5096	CLIP-seq
MIRT1426915	hsa-miR-548s	CLIP-seq
MIRT1426919	hsa-miR-588	CLIP-seq
MIRT1426933	hsa-miR-590-3p	CLIP-seq
MIRT1426921	hsa-miR-767-5p	CLIP-seq
MIRT1426886	hsa-miR-3149	CLIP-seq
MIRT1426892	hsa-miR-411	CLIP-seq
MIRT1426931	hsa-miR-4735-5p	CLIP-seq
MIRT1426932	hsa-miR-4775	CLIP-seq
MIRT1426933	hsa-miR-590-3p	CLIP-seq
MIRT1426921	hsa-miR-767-5p	CLIP-seq
MIRT1426877	hsa-miR-1193	CLIP-seq
MIRT1426883	hsa-miR-197	CLIP-seq
MIRT1426884	hsa-miR-2392	CLIP-seq
MIRT1426886	hsa-miR-3149	CLIP-seq
MIRT1426888	hsa-miR-3187-3p	CLIP-seq
MIRT1426892	hsa-miR-411	CLIP-seq
MIRT1426897	hsa-miR-4435	CLIP-seq
MIRT1426902	hsa-miR-4701-5p	CLIP-seq
MIRT1426905	hsa-miR-4716-5p	CLIP-seq
MIRT1426931	hsa-miR-4735-5p	CLIP-seq
MIRT1426932	hsa-miR-4775	CLIP-seq
MIRT1426909	hsa-miR-4781-3p	CLIP-seq
MIRT1426911	hsa-miR-5096	CLIP-seq
MIRT1426915	hsa-miR-548s	CLIP-seq
MIRT1426919	hsa-miR-588	CLIP-seq
MIRT1426933	hsa-miR-590-3p	CLIP-seq
MIRT1426921	hsa-miR-767-5p	CLIP-seq
MIRT1426877	hsa-miR-1193	CLIP-seq
MIRT1426883	hsa-miR-197	CLIP-seq
MIRT1426884	hsa-miR-2392	CLIP-seq
MIRT1426886	hsa-miR-3149	CLIP-seq
MIRT1426888	hsa-miR-3187-3p	CLIP-seq
MIRT1426892	hsa-miR-411	CLIP-seq
MIRT1426897	hsa-miR-4435	CLIP-seq
MIRT1426902	hsa-miR-4701-5p	CLIP-seq
MIRT1426905	hsa-miR-4716-5p	CLIP-seq
MIRT1426931	hsa-miR-4735-5p	CLIP-seq
MIRT1426932	hsa-miR-4775	CLIP-seq
MIRT1426909	hsa-miR-4781-3p	CLIP-seq
MIRT1426911	hsa-miR-5096	CLIP-seq
MIRT1426915	hsa-miR-548s	CLIP-seq
MIRT1426919	hsa-miR-588	CLIP-seq
MIRT1426933	hsa-miR-590-3p	CLIP-seq
MIRT1426921	hsa-miR-767-5p	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
FOXP3	Unknown	17641056
RXRA	Unknown	24373795
VDR	Unknown	24373795

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002224	Process	Toll-like receptor signaling pathway	IBA
GO:0002224	Process	Toll-like receptor signaling pathway	IEA
GO:0002224	Process	Toll-like receptor signaling pathway	ISS
GO:0002376	Process	Immune system process	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	11267672
GO:0005515	Function	Protein binding	IPI	15728506, 23155421, 32814053
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	NAS	33576548
GO:0005886	Component	Plasma membrane	TAS
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	NAS	11267672
GO:0007165	Process	Signal transduction	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	11267672
GO:0035663	Function	Toll-like receptor 2 binding	IBA
GO:0038023	Function	Signaling receptor activity	IBA
GO:0042802	Function	Identical protein binding	IPI	15728506, 23155421
GO:0043235	Component	Receptor complex	IEA
GO:0043235	Component	Receptor complex	IPI	23155421
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	NAS	33576548
GO:0061809	Function	NAD+ nucleosidase activity, cyclic ADP-ribose generating	IEA
GO:0071221	Process	Cellular response to bacterial lipopeptide	IBA
GO:0071723	Function	Lipopeptide binding	IBA

MIM	HGNC	e!Ensembl
606270	15634	ENSG00000174123

Q9BXR5

Protein name

Toll-like receptor 10 (CD antigen CD290)

Protein function

Participates in the innate immune response to microbial agents. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response (By similarity).

PDB

2J67

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00560	LRR_1	50 → 71	Leucine Rich Repeat	Repeat
PF13855	LRR_8	72 → 129	Leucine rich repeat	Repeat
PF01582	TIR	633 → 802	TIR domain	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in spleen, lymph node, thymus, tonsil and at lower levels in lung. Highly expressed in promyelocytic HL-60 cells and in B-cell lines.

Sequence

MRLIRNIYIFCSIVMTAEGDAPELPEERELMTNCSNMSLRKVPADLTPATTTLDLSYNLL
FQLQSSDFHSVSKLRVLILCHNRIQQLDLKTFEFNKELRYLDLSNNRLKSVTWYLLAGLR
YLDLSFNDFDTMPICEEAGNMSHLEILGLSGAKIQKSDFQKIAHLHLNTVFLGFRTLPHY
EEGSLPILNTTKLHIVLPMDTNFWVLLRDGIKTSKILEMTNIDGKSQFVSYEMQRNLSLE
NAKTSVLLLNKVDLLWDDLFLILQFVWHTSVEHFQIRNVTFGGKAYLDHNSFDYSNTVMR
TIKLEHVHFRVFYIQQDKIYLLLTKMDIENLTISNAQMPHMLFPNYPTKFQYLNFANNIL
TDELFKRTIQLPHLKTLILNGNKLETLSLVSCFANNTPLEHLDLSQNLLQHKNDENCSWP
ETVVNMNLSYNKLSDSVFRCLPKSIQILDLNNNQIQTVPKETIHLMALRELNIAFNFLTD
LPGCSHFSRLSVLNIEMNFILSPSLDFVQSCQEVKTLNAGRNPFRCTCELKNFIQLETYS
EVMMVGWSDSYTCEYPLNLRGTRLKDVHLHELSCNTALLIVTIVVIMLVLGLAVAFCCLH
FDLPWYLRMLGQCTQTWHRVRKTTQEQLKRNVRFHAFISYSEHDSLWVKNELIPNLEKED
GSILICLYESYFDPGKSISENIVSFIEKSYKSIFVLSPNFVQNEWCHYEFYFAHHNLFHE
NSDHIILILLEPIPFYCIPTRYHKLKALLEKKAYLEWPKDRRKCGLFWANLRAAINVNVL
ATREMYELQTFTELNEESRGSTISLMRTDCL

Sequence length

811

Interactions

View interactions

	Reactome
			Toll Like Receptor 10 (TLR10) Cascade IRAK4 deficiency (TLR5) MyD88 cascade initiated on plasma membrane

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANTI-TOPOISOMERASE-I-ANTIBODY-POSITIVE SYSTEMIC SCLERODERMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEFICIENCY ANEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL ARTERIAL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (84)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	38256138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	23946637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	28228119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	17652175	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	Pubtator	24336024	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	27716427, 30686934, 31376255, 32365786	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	15201134, 16505608, 20444155, 24112285, 28592890, 28692144, 30924193		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	15201134		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	19247692, 28592890	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	GWASCAT_DG	29785011		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	22504414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20618976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20618976, 31789409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	27498757, 28592890, 28692144, 30924193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	28592890	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	20826912	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	12689944	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	22504414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	33907270	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	36012132	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	31272954	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Q Fever	Q Fever	BEFREE	26364993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20728343, 29566186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29566186	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	21716313, 22342453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29194748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	29428931	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	36552771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29428931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	21499082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	28368946, 28699598, 32719215	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32287174	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	32287174	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	22703024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	25028161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	25028161	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	31073143		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	20953797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	31272954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	21478107	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	34695167	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	32287174	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	21886837	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	40011954	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	32287174	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	12689944	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	19029192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	28699598	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20618976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15812078, 17932345, 18752252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26559190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	22504414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	19029192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meniere Disease	Meniere Disease	BEFREE	23370977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	20406964	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	12689944, 20629663	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	20629663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	29381915	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	16702361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22504414, 23124277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29428931, 29698883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29428931	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic neuritis	Pubtator	36969199	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	29194748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis Hip	Osteoarthritis	Pubtator	29194748, 29980729	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	BEFREE	29194748, 29980729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	23124277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic ulcer disease	Pubtator	26559190, 32719215, 34420402	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	GWASCAT_DG	27082954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15812078, 17932345, 18752252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15812078, 17932345, 18752252		★★★★★ ★☆☆☆☆ Found in Text Mining only
prostatitis	Prostatitis	BEFREE	30618413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	36671404	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	27716427, 30686934, 30983882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	20815312, 28228119	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	22150367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26559190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	32719215	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26559190	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	24959869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	28843340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	39208235	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	31272954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	31272954	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TLR10 (toll like receptor 10)