Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8178
Gene name	Elongation factor for RNA polymerase II
Gene symbol	ELL
Synonyms (NCBI Gene)	C19orf17ELL1MENPPP1R68
Chromosome	19
Chromosome location	19p13.11

207

Show/Hide all (207)

miRTarBase ID	miRNA	Experiments	Reference
MIRT039101	hsa-miR-769-3p	CLASH	23622248
MIRT960708	hsa-miR-1207-5p	CLIP-seq
MIRT960709	hsa-miR-1238	CLIP-seq
MIRT960710	hsa-miR-1252	CLIP-seq
MIRT960711	hsa-miR-1269	CLIP-seq
MIRT960712	hsa-miR-1269b	CLIP-seq
MIRT960713	hsa-miR-1275	CLIP-seq
MIRT960714	hsa-miR-1288	CLIP-seq
MIRT960715	hsa-miR-1343	CLIP-seq
MIRT960716	hsa-miR-15a	CLIP-seq
MIRT960717	hsa-miR-15b	CLIP-seq
MIRT960718	hsa-miR-16	CLIP-seq
MIRT960719	hsa-miR-1909	CLIP-seq
MIRT960720	hsa-miR-1915	CLIP-seq
MIRT960721	hsa-miR-195	CLIP-seq
MIRT960722	hsa-miR-2278	CLIP-seq
MIRT960723	hsa-miR-24	CLIP-seq
MIRT960724	hsa-miR-2467-3p	CLIP-seq
MIRT960725	hsa-miR-30a	CLIP-seq
MIRT960726	hsa-miR-30b	CLIP-seq
MIRT960727	hsa-miR-30c	CLIP-seq
MIRT960728	hsa-miR-30d	CLIP-seq
MIRT960729	hsa-miR-30e	CLIP-seq
MIRT960730	hsa-miR-3117-5p	CLIP-seq
MIRT960731	hsa-miR-3120-3p	CLIP-seq
MIRT960732	hsa-miR-3121-3p	CLIP-seq
MIRT960733	hsa-miR-3130-3p	CLIP-seq
MIRT960734	hsa-miR-3150a-3p	CLIP-seq
MIRT960735	hsa-miR-3170	CLIP-seq
MIRT960736	hsa-miR-3175	CLIP-seq
MIRT960737	hsa-miR-3180	CLIP-seq
MIRT960738	hsa-miR-3180-3p	CLIP-seq
MIRT960739	hsa-miR-3184	CLIP-seq
MIRT960740	hsa-miR-3196	CLIP-seq
MIRT960741	hsa-miR-342-5p	CLIP-seq
MIRT960742	hsa-miR-3591-3p	CLIP-seq
MIRT960743	hsa-miR-3612	CLIP-seq
MIRT960744	hsa-miR-361-3p	CLIP-seq
MIRT960745	hsa-miR-3615	CLIP-seq
MIRT960746	hsa-miR-3622a-5p	CLIP-seq
MIRT960747	hsa-miR-371b-5p	CLIP-seq
MIRT960748	hsa-miR-3978	CLIP-seq
MIRT960749	hsa-miR-423-5p	CLIP-seq
MIRT960750	hsa-miR-424	CLIP-seq
MIRT960751	hsa-miR-4260	CLIP-seq
MIRT960752	hsa-miR-4274	CLIP-seq
MIRT960753	hsa-miR-4284	CLIP-seq
MIRT960754	hsa-miR-4290	CLIP-seq
MIRT960755	hsa-miR-4328	CLIP-seq
MIRT960756	hsa-miR-4423-3p	CLIP-seq
MIRT960757	hsa-miR-4436b-3p	CLIP-seq
MIRT960758	hsa-miR-4449	CLIP-seq
MIRT960759	hsa-miR-4492	CLIP-seq
MIRT960760	hsa-miR-4498	CLIP-seq
MIRT960761	hsa-miR-4515	CLIP-seq
MIRT960762	hsa-miR-4519	CLIP-seq
MIRT960763	hsa-miR-4524	CLIP-seq
MIRT960764	hsa-miR-4525	CLIP-seq
MIRT960765	hsa-miR-4529-3p	CLIP-seq
MIRT960766	hsa-miR-4532	CLIP-seq
MIRT960767	hsa-miR-4651	CLIP-seq
MIRT960768	hsa-miR-4654	CLIP-seq
MIRT960769	hsa-miR-4664-5p	CLIP-seq
MIRT960770	hsa-miR-4665-5p	CLIP-seq
MIRT960771	hsa-miR-4667-5p	CLIP-seq
MIRT960772	hsa-miR-4685-5p	CLIP-seq
MIRT960773	hsa-miR-4687-3p	CLIP-seq
MIRT960774	hsa-miR-4695-5p	CLIP-seq
MIRT960775	hsa-miR-4698	CLIP-seq
MIRT960776	hsa-miR-4700-5p	CLIP-seq
MIRT960777	hsa-miR-4704-5p	CLIP-seq
MIRT960778	hsa-miR-4723-5p	CLIP-seq
MIRT960779	hsa-miR-4726-3p	CLIP-seq
MIRT960780	hsa-miR-4740-5p	CLIP-seq
MIRT960781	hsa-miR-4763-3p	CLIP-seq
MIRT960782	hsa-miR-4769-5p	CLIP-seq
MIRT960783	hsa-miR-4796-3p	CLIP-seq
MIRT960784	hsa-miR-494	CLIP-seq
MIRT960785	hsa-miR-497	CLIP-seq
MIRT960786	hsa-miR-511	CLIP-seq
MIRT960787	hsa-miR-516a-3p	CLIP-seq
MIRT960788	hsa-miR-548n	CLIP-seq
MIRT960789	hsa-miR-548t	CLIP-seq
MIRT960790	hsa-miR-578	CLIP-seq
MIRT960791	hsa-miR-608	CLIP-seq
MIRT960792	hsa-miR-625	CLIP-seq
MIRT960793	hsa-miR-626	CLIP-seq
MIRT960794	hsa-miR-643	CLIP-seq
MIRT960795	hsa-miR-650	CLIP-seq
MIRT960796	hsa-miR-671-5p	CLIP-seq
MIRT960797	hsa-miR-762	CLIP-seq
MIRT960798	hsa-miR-9	CLIP-seq
MIRT960799	hsa-miR-939	CLIP-seq
MIRT960723	hsa-miR-24	CLIP-seq
MIRT960725	hsa-miR-30a	CLIP-seq
MIRT960726	hsa-miR-30b	CLIP-seq
MIRT960727	hsa-miR-30c	CLIP-seq
MIRT960728	hsa-miR-30d	CLIP-seq
MIRT960729	hsa-miR-30e	CLIP-seq
MIRT960742	hsa-miR-3591-3p	CLIP-seq
MIRT960747	hsa-miR-371b-5p	CLIP-seq
MIRT960753	hsa-miR-4284	CLIP-seq
MIRT960775	hsa-miR-4698	CLIP-seq
MIRT960790	hsa-miR-578	CLIP-seq
MIRT960794	hsa-miR-643	CLIP-seq
MIRT1984735	hsa-miR-1184	CLIP-seq
MIRT1984736	hsa-miR-1197	CLIP-seq
MIRT1984737	hsa-miR-1205	CLIP-seq
MIRT1984738	hsa-miR-128	CLIP-seq
MIRT960720	hsa-miR-1915	CLIP-seq
MIRT1984739	hsa-miR-28-3p	CLIP-seq
MIRT960725	hsa-miR-30a	CLIP-seq
MIRT960726	hsa-miR-30b	CLIP-seq
MIRT960727	hsa-miR-30c	CLIP-seq
MIRT960728	hsa-miR-30d	CLIP-seq
MIRT960729	hsa-miR-30e	CLIP-seq
MIRT960730	hsa-miR-3117-5p	CLIP-seq
MIRT1984740	hsa-miR-3177-5p	CLIP-seq
MIRT960742	hsa-miR-3591-3p	CLIP-seq
MIRT1984741	hsa-miR-3653	CLIP-seq
MIRT1984742	hsa-miR-3658	CLIP-seq
MIRT1984743	hsa-miR-3677-5p	CLIP-seq
MIRT960747	hsa-miR-371b-5p	CLIP-seq
MIRT960748	hsa-miR-3978	CLIP-seq
MIRT1984744	hsa-miR-4280	CLIP-seq
MIRT1984745	hsa-miR-432	CLIP-seq
MIRT960757	hsa-miR-4436b-3p	CLIP-seq
MIRT1984746	hsa-miR-4468	CLIP-seq
MIRT1984747	hsa-miR-4512	CLIP-seq
MIRT1984748	hsa-miR-4514	CLIP-seq
MIRT960772	hsa-miR-4685-5p	CLIP-seq
MIRT1984749	hsa-miR-4690-5p	CLIP-seq
MIRT1984750	hsa-miR-4692	CLIP-seq
MIRT960775	hsa-miR-4698	CLIP-seq
MIRT960777	hsa-miR-4704-5p	CLIP-seq
MIRT1984751	hsa-miR-548a-3p	CLIP-seq
MIRT1984752	hsa-miR-548an	CLIP-seq
MIRT1984753	hsa-miR-548e	CLIP-seq
MIRT1984754	hsa-miR-548f	CLIP-seq
MIRT960790	hsa-miR-578	CLIP-seq
MIRT960794	hsa-miR-643	CLIP-seq
MIRT1984755	hsa-miR-711	CLIP-seq
MIRT1984756	hsa-miR-890	CLIP-seq
MIRT1984757	hsa-miR-940	CLIP-seq
MIRT1984737	hsa-miR-1205	CLIP-seq
MIRT2219617	hsa-miR-1286	CLIP-seq
MIRT960716	hsa-miR-15a	CLIP-seq
MIRT960717	hsa-miR-15b	CLIP-seq
MIRT960718	hsa-miR-16	CLIP-seq
MIRT960720	hsa-miR-1915	CLIP-seq
MIRT960721	hsa-miR-195	CLIP-seq
MIRT2219618	hsa-miR-200b	CLIP-seq
MIRT2219619	hsa-miR-200c	CLIP-seq
MIRT2219620	hsa-miR-217	CLIP-seq
MIRT960725	hsa-miR-30a	CLIP-seq
MIRT960726	hsa-miR-30b	CLIP-seq
MIRT960727	hsa-miR-30c	CLIP-seq
MIRT960728	hsa-miR-30d	CLIP-seq
MIRT960729	hsa-miR-30e	CLIP-seq
MIRT960742	hsa-miR-3591-3p	CLIP-seq
MIRT960748	hsa-miR-3978	CLIP-seq
MIRT960750	hsa-miR-424	CLIP-seq
MIRT2219621	hsa-miR-429	CLIP-seq
MIRT2219622	hsa-miR-4418	CLIP-seq
MIRT960757	hsa-miR-4436b-3p	CLIP-seq
MIRT1984748	hsa-miR-4514	CLIP-seq
MIRT960772	hsa-miR-4685-5p	CLIP-seq
MIRT1984750	hsa-miR-4692	CLIP-seq
MIRT960783	hsa-miR-4796-3p	CLIP-seq
MIRT960785	hsa-miR-497	CLIP-seq
MIRT2219623	hsa-miR-509-3-5p	CLIP-seq
MIRT2219624	hsa-miR-509-5p	CLIP-seq
MIRT960789	hsa-miR-548t	CLIP-seq
MIRT960790	hsa-miR-578	CLIP-seq
MIRT960794	hsa-miR-643	CLIP-seq
MIRT1984755	hsa-miR-711	CLIP-seq
MIRT2219625	hsa-miR-885-3p	CLIP-seq
MIRT1984757	hsa-miR-940	CLIP-seq
MIRT2387353	hsa-miR-1179	CLIP-seq
MIRT960743	hsa-miR-3612	CLIP-seq
MIRT2387354	hsa-miR-3622a-3p	CLIP-seq
MIRT2387355	hsa-miR-3622b-3p	CLIP-seq
MIRT2387356	hsa-miR-4310	CLIP-seq
MIRT960795	hsa-miR-650	CLIP-seq
MIRT2219625	hsa-miR-885-3p	CLIP-seq
MIRT960711	hsa-miR-1269	CLIP-seq
MIRT960712	hsa-miR-1269b	CLIP-seq
MIRT960714	hsa-miR-1288	CLIP-seq
MIRT960720	hsa-miR-1915	CLIP-seq
MIRT2522923	hsa-miR-2277-3p	CLIP-seq
MIRT960724	hsa-miR-2467-3p	CLIP-seq
MIRT960737	hsa-miR-3180	CLIP-seq
MIRT960738	hsa-miR-3180-3p	CLIP-seq
MIRT960739	hsa-miR-3184	CLIP-seq
MIRT960740	hsa-miR-3196	CLIP-seq
MIRT960749	hsa-miR-423-5p	CLIP-seq
MIRT960757	hsa-miR-4436b-3p	CLIP-seq
MIRT960758	hsa-miR-4449	CLIP-seq
MIRT960759	hsa-miR-4492	CLIP-seq
MIRT960760	hsa-miR-4498	CLIP-seq
MIRT960761	hsa-miR-4515	CLIP-seq
MIRT960765	hsa-miR-4529-3p	CLIP-seq
MIRT960766	hsa-miR-4532	CLIP-seq
MIRT960772	hsa-miR-4685-5p	CLIP-seq
MIRT960779	hsa-miR-4726-3p	CLIP-seq
MIRT960780	hsa-miR-4740-5p	CLIP-seq
MIRT960797	hsa-miR-762	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
EAF1	Activation	16006523

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000791	Component	Euchromatin	IDA	23932780
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IBA
GO:0001701	Process	In utero embryonic development	IEA
GO:0005515	Function	Protein binding	IPI	19389623, 19819239, 21729782, 22195968, 23932780, 24413172
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0006368	Process	Transcription elongation by RNA polymerase II	IEA
GO:0006368	Process	Transcription elongation by RNA polymerase II	TAS	8596958
GO:0008023	Component	Transcription elongation factor complex	IBA
GO:0008023	Component	Transcription elongation factor complex	IDA	22195968, 23932780
GO:0008023	Component	Transcription elongation factor complex	IEA
GO:0015030	Component	Cajal body	IDA	22195968, 23932780
GO:0015030	Component	Cajal body	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0016607	Component	Nuclear speck	IDA	19389623
GO:0016607	Component	Nuclear speck	IEA
GO:0019902	Function	Phosphatase binding	IDA	19389623
GO:0032786	Process	Positive regulation of DNA-templated transcription, elongation	TAS	8596958
GO:0032968	Process	Positive regulation of transcription elongation by RNA polymerase II	IBA
GO:0032968	Process	Positive regulation of transcription elongation by RNA polymerase II	IMP	23932780
GO:0035363	Component	Histone locus body	IDA	23932780
GO:0042795	Process	SnRNA transcription by RNA polymerase II	IBA
GO:0042795	Process	SnRNA transcription by RNA polymerase II	IEA
GO:0042795	Process	SnRNA transcription by RNA polymerase II	IMP	22195968, 23932780
GO:0042796	Process	SnRNA transcription by RNA polymerase III	IMP	23932780
GO:0045945	Process	Positive regulation of transcription by RNA polymerase III	IMP	23932780

MIM	HGNC	e!Ensembl
600284	23114	ENSG00000105656

P55199

Protein name

RNA polymerase II elongation factor ELL (Eleven-nineteen lysine-rich leukemia protein)

Protein function

Elongation factor component of the super elongation complex (SEC), a complex required to increase the catalytic rate of RNA polymerase II transcription by suppressing transient pausing by the polymerase at multiple sites along the DNA. Elongatio

PDB

2DOA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10390	ELL	6 → 292	RNA polymerase II elongation factor ELL	Family
PF07303	Occludin_ELL	513 → 614	Occludin homology domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in all tissues tested. Highest levels found in placenta, skeletal muscle, testis and peripheral blood leukocytes.

Sequence

MAALKEDRSYGLSCGRVSDGSKVSVFHVKLTDSALRAFESYRARQDSVSLRPSIRFQGSQ
GHISIPQPDCPAEARTFSFYLSNIGRDNPQGSFDCIQQYVSSHGEVHLDCLGSIQDKITV
CATDDSYQKARQSMAQAEEETRSRSAIVIKAGGRYLGKKVQFRKPAPGATDAVPSRKRAT
PINLASAIRKSGASAVSGGSGVSQRPFRDRVLHLLALRPYRKAELLLRLQKDGLTQADKD
ALDGLLQQVANMSAKDGTCTLQDCMYKDVQKDWPGYSEGDQQLLKRVLVRKLCQPQSTGS
LLGDPAASSPPGERGRSASPPQKRLQPPDFIDPLANKKPRISHFTQRAQPAVNGKLGVPN
GREALLPTPGPPASTDTLSSSTHLPPRLEPPRAHDPLADVSNDLGHSGRDCEHGEAAAPA
PTVRLGLPLLTDCAQPSRPHGSPSRSKPKKKSKKHKDKERAAEDKPRAQLPDCAPATHAT
PGAPADTPGLNGTCSVSSVPTSTSETPDYLLKYAAISSSEQRQSYKNDFNAEYSEYRDLH
ARIERITRRFTQLDAQLRQLSQGSEEYETTRGQILQEYRKIKKTNTNYSQEKHRCEYLHS
KLAHIKRLIAEYDQRQLQAWP

Sequence length

621

Interactions

View interactions

	KEGG		Reactome
	Viral life cycle - HIV-1		Formation of RNA Pol II elongation complex RNA Polymerase II Pre-transcription Events Transcription-Coupled Nucleotide Excision Repair (TC-NER) TP53 Regulates Transcription of DNA Repair Genes RNA polymerase II transcribes snRNA genes RNA Polymerase II Transcription Elongation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (18)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ATHEROSCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUPUYTREN CONTRACTURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (23)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute leukemia	Leukemia	BEFREE	12446457, 12686606, 8639852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	19405140, 30974445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute myeloid leukemia, minimal differentiation	Myeloid Leukemia	BEFREE	28669059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	23535729, 25751625, 29059683		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	31026346		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	23593120, 25227710	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	18617060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	11238904, 12686606	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	12686606, 12773566, 20159561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10419521, 10882741, 11238904, 17044034, 21900057, 36543308, 7991593, 8639852, 9268387	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10419521, 17044034, 18617060, 24344198, 25758097, 28669059, 30974445, 8596958, 8639852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	16086288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	18617060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	GWASDB_DG	23535729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31026346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24260246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11238904, 24727455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24260246, 27009366, 8596958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24260246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27058417	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	28870994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	8596958		★★★★★ ★☆☆☆☆ Found in Text Mining only

ELL (elongation factor for RNA polymerase II)