Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8170
Gene name	Solute carrier family 14 member 2
Gene symbol	SLC14A2
Synonyms (NCBI Gene)	HUT2UT-A2UT2UTAUTRhUT-A6
Chromosome	18
Chromosome location	18q12.3
Summary	The protein encoded by this gene belongs to the urea transporter family. In mammalian cells, urea is the chief end product of nitrogen catabolism, and plays an important role in the urinary concentration mechanism. This protein is expressed in the inner m

191

Show/Hide all (191)

miRTarBase ID	miRNA	Experiments
MIRT1352598	hsa-miR-106a	CLIP-seq
MIRT1352599	hsa-miR-106b	CLIP-seq
MIRT1352600	hsa-miR-1193	CLIP-seq
MIRT1352601	hsa-miR-1234	CLIP-seq
MIRT1352602	hsa-miR-1254	CLIP-seq
MIRT1352603	hsa-miR-150	CLIP-seq
MIRT1352604	hsa-miR-17	CLIP-seq
MIRT1352605	hsa-miR-185	CLIP-seq
MIRT1352606	hsa-miR-1976	CLIP-seq
MIRT1352607	hsa-miR-20a	CLIP-seq
MIRT1352608	hsa-miR-20b	CLIP-seq
MIRT1352609	hsa-miR-2110	CLIP-seq
MIRT1352610	hsa-miR-2392	CLIP-seq
MIRT1352611	hsa-miR-302a	CLIP-seq
MIRT1352612	hsa-miR-302b	CLIP-seq
MIRT1352613	hsa-miR-302c	CLIP-seq
MIRT1352614	hsa-miR-302d	CLIP-seq
MIRT1352615	hsa-miR-302e	CLIP-seq
MIRT1352616	hsa-miR-3116	CLIP-seq
MIRT1352617	hsa-miR-3150a-3p	CLIP-seq
MIRT1352618	hsa-miR-3175	CLIP-seq
MIRT1352619	hsa-miR-3199	CLIP-seq
MIRT1352620	hsa-miR-372	CLIP-seq
MIRT1352621	hsa-miR-373	CLIP-seq
MIRT1352622	hsa-miR-4258	CLIP-seq
MIRT1352623	hsa-miR-4260	CLIP-seq
MIRT1352624	hsa-miR-4306	CLIP-seq
MIRT1352625	hsa-miR-4644	CLIP-seq
MIRT1352626	hsa-miR-4707-3p	CLIP-seq
MIRT1352627	hsa-miR-4731-5p	CLIP-seq
MIRT1352628	hsa-miR-4735-5p	CLIP-seq
MIRT1352629	hsa-miR-4775	CLIP-seq
MIRT1352630	hsa-miR-4794	CLIP-seq
MIRT1352631	hsa-miR-512-3p	CLIP-seq
MIRT1352632	hsa-miR-519d	CLIP-seq
MIRT1352633	hsa-miR-520a-3p	CLIP-seq
MIRT1352634	hsa-miR-520b	CLIP-seq
MIRT1352635	hsa-miR-520c-3p	CLIP-seq
MIRT1352636	hsa-miR-520d-3p	CLIP-seq
MIRT1352637	hsa-miR-520e	CLIP-seq
MIRT1352638	hsa-miR-520g	CLIP-seq
MIRT1352639	hsa-miR-520h	CLIP-seq
MIRT1352640	hsa-miR-552	CLIP-seq
MIRT1352641	hsa-miR-562	CLIP-seq
MIRT1352642	hsa-miR-590-3p	CLIP-seq
MIRT1352643	hsa-miR-599	CLIP-seq
MIRT1352644	hsa-miR-640	CLIP-seq
MIRT1352645	hsa-miR-661	CLIP-seq
MIRT1352646	hsa-miR-764	CLIP-seq
MIRT1352647	hsa-miR-93	CLIP-seq
MIRT1352648	hsa-miR-939	CLIP-seq
MIRT1352602	hsa-miR-1254	CLIP-seq
MIRT2104395	hsa-miR-129-5p	CLIP-seq
MIRT1352606	hsa-miR-1976	CLIP-seq
MIRT2104396	hsa-miR-2276	CLIP-seq
MIRT1352616	hsa-miR-3116	CLIP-seq
MIRT1352622	hsa-miR-4258	CLIP-seq
MIRT2104397	hsa-miR-4279	CLIP-seq
MIRT2104398	hsa-miR-4532	CLIP-seq
MIRT1352626	hsa-miR-4707-3p	CLIP-seq
MIRT2104399	hsa-miR-4722-3p	CLIP-seq
MIRT1352628	hsa-miR-4735-5p	CLIP-seq
MIRT1352629	hsa-miR-4775	CLIP-seq
MIRT1352630	hsa-miR-4794	CLIP-seq
MIRT1352642	hsa-miR-590-3p	CLIP-seq
MIRT1352645	hsa-miR-661	CLIP-seq
MIRT1352598	hsa-miR-106a	CLIP-seq
MIRT1352599	hsa-miR-106b	CLIP-seq
MIRT2328837	hsa-miR-122	CLIP-seq
MIRT1352601	hsa-miR-1234	CLIP-seq
MIRT1352603	hsa-miR-150	CLIP-seq
MIRT1352604	hsa-miR-17	CLIP-seq
MIRT1352606	hsa-miR-1976	CLIP-seq
MIRT1352607	hsa-miR-20a	CLIP-seq
MIRT1352608	hsa-miR-20b	CLIP-seq
MIRT2104396	hsa-miR-2276	CLIP-seq
MIRT2328838	hsa-miR-24	CLIP-seq
MIRT1352611	hsa-miR-302a	CLIP-seq
MIRT1352612	hsa-miR-302b	CLIP-seq
MIRT1352613	hsa-miR-302c	CLIP-seq
MIRT1352614	hsa-miR-302d	CLIP-seq
MIRT1352615	hsa-miR-302e	CLIP-seq
MIRT2328839	hsa-miR-3135b	CLIP-seq
MIRT2328840	hsa-miR-3164	CLIP-seq
MIRT1352619	hsa-miR-3199	CLIP-seq
MIRT2328841	hsa-miR-3652	CLIP-seq
MIRT1352620	hsa-miR-372	CLIP-seq
MIRT1352621	hsa-miR-373	CLIP-seq
MIRT1352622	hsa-miR-4258	CLIP-seq
MIRT2104397	hsa-miR-4279	CLIP-seq
MIRT2328842	hsa-miR-4284	CLIP-seq
MIRT2328843	hsa-miR-4430	CLIP-seq
MIRT2104398	hsa-miR-4532	CLIP-seq
MIRT1352626	hsa-miR-4707-3p	CLIP-seq
MIRT2104399	hsa-miR-4722-3p	CLIP-seq
MIRT2328844	hsa-miR-4773	CLIP-seq
MIRT1352631	hsa-miR-512-3p	CLIP-seq
MIRT1352632	hsa-miR-519d	CLIP-seq
MIRT1352633	hsa-miR-520a-3p	CLIP-seq
MIRT1352634	hsa-miR-520b	CLIP-seq
MIRT1352635	hsa-miR-520c-3p	CLIP-seq
MIRT1352636	hsa-miR-520d-3p	CLIP-seq
MIRT1352637	hsa-miR-520e	CLIP-seq
MIRT1352638	hsa-miR-520g	CLIP-seq
MIRT1352639	hsa-miR-520h	CLIP-seq
MIRT1352640	hsa-miR-552	CLIP-seq
MIRT1352641	hsa-miR-562	CLIP-seq
MIRT2328845	hsa-miR-617	CLIP-seq
MIRT1352644	hsa-miR-640	CLIP-seq
MIRT1352646	hsa-miR-764	CLIP-seq
MIRT1352647	hsa-miR-93	CLIP-seq
MIRT2328837	hsa-miR-122	CLIP-seq
MIRT1352602	hsa-miR-1254	CLIP-seq
MIRT2459488	hsa-miR-1273f	CLIP-seq
MIRT2104395	hsa-miR-129-5p	CLIP-seq
MIRT1352606	hsa-miR-1976	CLIP-seq
MIRT2104396	hsa-miR-2276	CLIP-seq
MIRT2328838	hsa-miR-24	CLIP-seq
MIRT1352616	hsa-miR-3116	CLIP-seq
MIRT2328839	hsa-miR-3135b	CLIP-seq
MIRT2459489	hsa-miR-3149	CLIP-seq
MIRT2328841	hsa-miR-3652	CLIP-seq
MIRT2459490	hsa-miR-411	CLIP-seq
MIRT1352622	hsa-miR-4258	CLIP-seq
MIRT2104397	hsa-miR-4279	CLIP-seq
MIRT2328842	hsa-miR-4284	CLIP-seq
MIRT2328843	hsa-miR-4430	CLIP-seq
MIRT2104398	hsa-miR-4532	CLIP-seq
MIRT1352626	hsa-miR-4707-3p	CLIP-seq
MIRT2104399	hsa-miR-4722-3p	CLIP-seq
MIRT1352628	hsa-miR-4735-5p	CLIP-seq
MIRT1352629	hsa-miR-4775	CLIP-seq
MIRT1352630	hsa-miR-4794	CLIP-seq
MIRT1352642	hsa-miR-590-3p	CLIP-seq
MIRT2459491	hsa-miR-615-5p	CLIP-seq
MIRT1352645	hsa-miR-661	CLIP-seq
MIRT1352602	hsa-miR-1254	CLIP-seq
MIRT2459488	hsa-miR-1273f	CLIP-seq
MIRT2104395	hsa-miR-129-5p	CLIP-seq
MIRT1352616	hsa-miR-3116	CLIP-seq
MIRT2459489	hsa-miR-3149	CLIP-seq
MIRT2459490	hsa-miR-411	CLIP-seq
MIRT1352628	hsa-miR-4735-5p	CLIP-seq
MIRT1352629	hsa-miR-4775	CLIP-seq
MIRT1352630	hsa-miR-4794	CLIP-seq
MIRT1352642	hsa-miR-590-3p	CLIP-seq
MIRT2459491	hsa-miR-615-5p	CLIP-seq
MIRT1352645	hsa-miR-661	CLIP-seq
MIRT2328837	hsa-miR-122	CLIP-seq
MIRT1352602	hsa-miR-1254	CLIP-seq
MIRT2459488	hsa-miR-1273f	CLIP-seq
MIRT2104395	hsa-miR-129-5p	CLIP-seq
MIRT2104396	hsa-miR-2276	CLIP-seq
MIRT2328838	hsa-miR-24	CLIP-seq
MIRT1352616	hsa-miR-3116	CLIP-seq
MIRT2328839	hsa-miR-3135b	CLIP-seq
MIRT2459489	hsa-miR-3149	CLIP-seq
MIRT2328841	hsa-miR-3652	CLIP-seq
MIRT2459490	hsa-miR-411	CLIP-seq
MIRT1352622	hsa-miR-4258	CLIP-seq
MIRT2328842	hsa-miR-4284	CLIP-seq
MIRT2328843	hsa-miR-4430	CLIP-seq
MIRT2104398	hsa-miR-4532	CLIP-seq
MIRT1352626	hsa-miR-4707-3p	CLIP-seq
MIRT1352628	hsa-miR-4735-5p	CLIP-seq
MIRT1352629	hsa-miR-4775	CLIP-seq
MIRT1352630	hsa-miR-4794	CLIP-seq
MIRT1352642	hsa-miR-590-3p	CLIP-seq
MIRT2459491	hsa-miR-615-5p	CLIP-seq
MIRT1352645	hsa-miR-661	CLIP-seq
MIRT2328837	hsa-miR-122	CLIP-seq
MIRT1352602	hsa-miR-1254	CLIP-seq
MIRT2459488	hsa-miR-1273f	CLIP-seq
MIRT2104395	hsa-miR-129-5p	CLIP-seq
MIRT2104396	hsa-miR-2276	CLIP-seq
MIRT2328838	hsa-miR-24	CLIP-seq
MIRT1352616	hsa-miR-3116	CLIP-seq
MIRT2328839	hsa-miR-3135b	CLIP-seq
MIRT2459489	hsa-miR-3149	CLIP-seq
MIRT2328841	hsa-miR-3652	CLIP-seq
MIRT2459490	hsa-miR-411	CLIP-seq
MIRT1352622	hsa-miR-4258	CLIP-seq
MIRT2328842	hsa-miR-4284	CLIP-seq
MIRT2328843	hsa-miR-4430	CLIP-seq
MIRT2104398	hsa-miR-4532	CLIP-seq
MIRT1352626	hsa-miR-4707-3p	CLIP-seq
MIRT1352628	hsa-miR-4735-5p	CLIP-seq
MIRT1352629	hsa-miR-4775	CLIP-seq
MIRT1352630	hsa-miR-4794	CLIP-seq
MIRT1352642	hsa-miR-590-3p	CLIP-seq
MIRT1352645	hsa-miR-661	CLIP-seq

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	17702749, 32296183
GO:0005886	Component	Plasma membrane	IDA	17702749
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0015204	Function	Urea transmembrane transporter activity	IDA	8647271, 8997401, 11502588, 17702749
GO:0015204	Function	Urea transmembrane transporter activity	IEA
GO:0015204	Function	Urea transmembrane transporter activity	TAS	8647271
GO:0015840	Process	Urea transport	IEA
GO:0015840	Process	Urea transport	TAS	8647271
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	8647271
GO:0016324	Component	Apical plasma membrane	IDA	17702749
GO:0016324	Component	Apical plasma membrane	IEA
GO:0050839	Function	Cell adhesion molecule binding	IDA	23620790
GO:0055085	Process	Transmembrane transport	TAS
GO:0071918	Process	Urea transmembrane transport	IBA
GO:0071918	Process	Urea transmembrane transport	IEA

MIM	HGNC	e!Ensembl
601611	10919	ENSG00000132874

Q15849

Protein name

Urea transporter 2 (Solute carrier family 14 member 2) (Urea transporter, kidney)

Protein function

[Isoform 1]: Mediates the transport of urea driven by a concentration gradient across the cell membrane of the renal inner medullary collecting duct which is critical to the urinary concentrating mechanism. {ECO:0000269|PubMed:11502588, ECO:0000

PDB

8BLO , 8XD7 , 8XD9 , 8XDA , 8XDB , 8XDC , 8XDD , 8XDE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03253	UT	119 → 414	Urea transporter	Family
PF03253	UT	581 → 876	Urea transporter	Family

Tissue specificity

TISSUE SPECIFICITY: [Isoform 1]: Epressed in the inner medulla of the kidney (at protein level). {ECO:0000269|PubMed:11502588}.; TISSUE SPECIFICITY: [Isoform 2]: Expressed in the kidney. {ECO:0000269|PubMed:8647271}.

Sequence

MSDPHSSPLLPEPLSSRYKLYEAEFTSPSWPSTSPDTHPALPLLEMPEEKDLRSSNEDSH
IVKIEKLNERSKRKDDGVAHRDSAGQRCICLSKAVGYLTGDMKEYRIWLKDKHLALQFID
WVLRGTAQVMFINNPLSGLIIFIGLLIQNPWWTITGGLGTVVSTLTALALGQDRSAIASG
LHGYNGMLVGLLMAVFSEKLDYYWWLLFPVTFTAMSCPVLSSALNSIFSKWDLPVFTLPF
NIAVTLYLAATGHYNLFFPTTLVEPVSSVPNITWTEMEMPLLLQAIPVGVGQVYGCDNPW
TGGVFLVALFISSPLICLHAAIGSIVGLLAALSVATPFETIYTGLWSYNCVLSCIAIGGM
FYALTWQTHLLALICALFCAYMEAAISNIMSVVGVPPGTWAFCLATIIFLLLTTNNPAIF
RLPLSKVTYPEANRIYYLTVKSGEEEKAPSGGGGEHPPTAGPKVEEGSEAVLSKHRSVFH
IEWSSIRRRSKVFGKGEHQERQNKDPFPYRYRKPTVELLDLDTMEESSEIKVETNISKTS
WIRSSMAASGKRVSKALSYITGEMKECGEGLKDKSPVFQFFDWVLRGTSQVMFVNNPLSG
ILIILGLFIQNPWWAISGCLGTIMSTLTALILSQDKSAIAAGFHGYNGVLVGLLMAVFSD
KGDYYWWLLLPVIIMSMSCPILSSALGTIFSKWDLPVFTLPFNITVTLYLAATGHYNLFF
PTTLLQPASAMPNITWSEVQVPLLLRAIPVGIGQVYGCDNPWTGGIFLIALFISSPLICL
HAAIGSTMGMLAALTIATPFDSIYFGLCGFNSTLACIAIGGMFYVITWQTHLLAIACALF
AAYLGAALANMLSVFGLPPCTWPFCLSALTFLLLTTNNPAIYKLPLSKVTYPEANRIYYL
SQERNRRASIITKYQAYDVS

Sequence length

920

Interactions

View interactions

	Reactome
			Transport of bile salts and organic acids, metal ions and amine compounds

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (27)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COR PULMONALE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR POSITIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERICARDITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VISUOSPATIAL IMPAIRMENT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (50)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	24372535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	GWASCAT_DG	28196072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia, Androgenetic, 1	Androgenetic Alopecia	GWASCAT_DG	22693459, 27182965, 29146897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia, Androgenetic, 2	Androgenetic Alopecia	GWASCAT_DG	22693459, 27182965, 29146897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia, Androgenetic, 3	Androgenetic Alopecia	GWASCAT_DG	22693459, 27182965, 29146897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia, Male Pattern	Alopecia, Male Pattern	GWASDB_DG	22693459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia, Male Pattern	Alopecia, Male Pattern	GWASCAT_DG	22693459, 27182965, 29146897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgenetic Alopecia	Androgenetic Alopecia	GWASCAT_DG	22693459, 27182965, 29146897		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	10644433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	12808434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25281903, 26650628		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	29059683		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	12808434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	17644387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	27981573	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	28806956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	24372535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20473940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Vasospasm	Coronary Artery Vasospasm	BEFREE	17652892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	20848455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	16636650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	19642097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	31785023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	26776194	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	10644433		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	10644433		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	10644433		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	10644433		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	10644433		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	10644433		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	10644433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25281903, 26650628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	19642097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12954495, 23292332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22750649, 26278624, 27677255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	24372535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	31785023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mature B-Cell Neoplasm	B-Cell Neoplasm	GWASCAT_DG	25279986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	20797394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	GWASDB_DG	19629137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22819824, 26095675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28521488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28409245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	23597578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12954495, 23292332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	16636650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28963582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	15003293, 28450949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	26274820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	23597578		★★★★★ ★☆☆☆☆ Found in Text Mining only

SLC14A2 (solute carrier family 14 member 2)