Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	81615
Gene name	Transmembrane protein 163
Gene symbol	TMEM163
Synonyms (NCBI Gene)	DC29HLD25SLC30A11SV31
Chromosome	2
Chromosome location	2q21.3

Show/Hide all (28)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017779	hsa-miR-335-5p	Microarray	18185580
MIRT641381	hsa-miR-1255b-2-3p	HITS-CLIP	23824327
MIRT641381	hsa-miR-1255b-2-3p	HITS-CLIP	23824327
MIRT1431799	hsa-miR-125a-3p	CLIP-seq
MIRT1431800	hsa-miR-1271	CLIP-seq
MIRT1431801	hsa-miR-3156-5p	CLIP-seq
MIRT1431802	hsa-miR-3650	CLIP-seq
MIRT1431803	hsa-miR-3665	CLIP-seq
MIRT1431804	hsa-miR-3927	CLIP-seq
MIRT1431805	hsa-miR-4488	CLIP-seq
MIRT1431806	hsa-miR-4519	CLIP-seq
MIRT1431807	hsa-miR-4695-3p	CLIP-seq
MIRT1431808	hsa-miR-4697-5p	CLIP-seq
MIRT1431809	hsa-miR-4736	CLIP-seq
MIRT1431810	hsa-miR-4793-5p	CLIP-seq
MIRT1431811	hsa-miR-660	CLIP-seq
MIRT1431812	hsa-miR-935	CLIP-seq
MIRT1431813	hsa-miR-96	CLIP-seq
MIRT2129445	hsa-miR-1910	CLIP-seq
MIRT2129446	hsa-miR-193a-5p	CLIP-seq
MIRT2129447	hsa-miR-3689d	CLIP-seq
MIRT2129448	hsa-miR-4264	CLIP-seq
MIRT2129449	hsa-miR-4527	CLIP-seq
MIRT2129450	hsa-miR-455-3p	CLIP-seq
MIRT2129451	hsa-miR-4717-3p	CLIP-seq
MIRT2129452	hsa-miR-4802-3p	CLIP-seq
MIRT2129453	hsa-miR-490-5p	CLIP-seq
MIRT2129454	hsa-miR-767-3p	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25130899, 36204728
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005768	Component	Endosome	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0008270	Function	Zinc ion binding	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	ISS
GO:0016020	Component	Membrane	IEA
GO:0030672	Component	Synaptic vesicle membrane	IBA
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0030672	Component	Synaptic vesicle membrane	ISS
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031901	Component	Early endosome membrane	IEA
GO:0031901	Component	Early endosome membrane	ISS
GO:0031902	Component	Late endosome membrane	IEA
GO:0042552	Process	Myelination	IMP	35455965
GO:0045202	Component	Synapse	IEA
GO:0071577	Process	Zinc ion transmembrane transport	IEA
GO:0099180	Process	Zinc ion import into synaptic vesicle	IEA
GO:0140882	Process	Zinc export across plasma membrane	IDA	31697912

MIM	HGNC	e!Ensembl
618978	25380	ENSG00000152128

Q8TC26

Protein name

Transmembrane protein 163

Protein function

Zinc ion transporter that mediates zinc efflux and plays a crucial role in intracellular zinc homeostasis (PubMed:25130899, PubMed:31697912, PubMed:36204728). Binds the divalent cations Zn(2+), Ni(2+), and to a minor extent Cu(2+) (By similarity

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. High expression is detected in brain, lung and testis. {ECO:0000269|PubMed:25130899}.

Sequence

MEPAAGIQRRSSQGPTVPPPPRGHAPPAAAPGPAPLSSPVREPPQLEEERQVRISESGQF
SDGLEDRGLLESSTRLKPHEAQNYRKKALWVSWFSIIVTLALAVAAFTVSVMRYSASAFG
FAFDAILDVLSSAIVLWRYSNAAAVHSAHREYIACVILGVIFLLSSICIVVKAIHDLSTR
LLPEVDDFLFSVSILSGILCSILAVLKFMLGKVLTSRALITDGFNSLVGGVMGFSILLSA
EVFKHDSAVWYLDGSIGVLIGLTIFAYGVKLLIDMVPRVRQTRHYEMFE

Sequence length

289

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Leukodystrophy, hypomyelinating, 25	Likely pathogenic; Pathogenic	rs2467325671, rs2468508886, rs2468508848	RCV003152356 RCV003152357 RCV003152358 RCV003152359	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (16)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY LIVER CIRRHOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS MELANOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOCRINE NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LARGE ARTERY STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKODYSTROPHY	—	HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSTRUCTIVE SLEEP APNEA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CIRRHOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (8)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	33574088	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASDB_DG	17634449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	26290879	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	23209189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	26290879, 28258026, 31813547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucolipidosis Type IV	Mucolipidosis	BEFREE	25130899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	26601739, 27393345, 31430546		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	27393345, 33523105	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

TMEM163 (transmembrane protein 163)