TRIM11 (tripartite motif containing 11)

Gene

• Entrez ID: 81559
• Gene name: Tripartite motif containing 11
• Gene symbol: TRIM11
• Synonyms (NCBI Gene): BIA1, RNF92
• Chromosome: 1
• Chromosome location: 1q42.13
• Summary: The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to the nucleus and the cyto

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT050803	hsa-miR-17-5p	CLASH	23622248
MIRT1452896	hsa-miR-1178	CLIP-seq
MIRT1452897	hsa-miR-1208	CLIP-seq
MIRT1452898	hsa-miR-1253	CLIP-seq
MIRT1452899	hsa-miR-1915	CLIP-seq
MIRT1452900	hsa-miR-193a-3p	CLIP-seq
MIRT1452901	hsa-miR-193b	CLIP-seq
MIRT1452902	hsa-miR-2355-5p	CLIP-seq
MIRT1452903	hsa-miR-3132	CLIP-seq
MIRT1452904	hsa-miR-3909	CLIP-seq
MIRT1452905	hsa-miR-3921	CLIP-seq
MIRT1452906	hsa-miR-4251	CLIP-seq
MIRT1452907	hsa-miR-4252	CLIP-seq
MIRT1452908	hsa-miR-4326	CLIP-seq
MIRT1452909	hsa-miR-4329	CLIP-seq
MIRT1452910	hsa-miR-4421	CLIP-seq
MIRT1452911	hsa-miR-4433	CLIP-seq
MIRT1452912	hsa-miR-4451	CLIP-seq
MIRT1452913	hsa-miR-4653-5p	CLIP-seq
MIRT1452914	hsa-miR-4691-5p	CLIP-seq
MIRT1452915	hsa-miR-4733-3p	CLIP-seq
MIRT1452916	hsa-miR-4786-3p	CLIP-seq
MIRT1452917	hsa-miR-665	CLIP-seq
MIRT2135658	hsa-miR-1248	CLIP-seq
MIRT2135659	hsa-miR-1285	CLIP-seq
MIRT2135660	hsa-miR-1299	CLIP-seq
MIRT2135661	hsa-miR-140-3p	CLIP-seq
MIRT1452899	hsa-miR-1915	CLIP-seq
MIRT2135662	hsa-miR-1972	CLIP-seq
MIRT1452902	hsa-miR-2355-5p	CLIP-seq
MIRT1452903	hsa-miR-3132	CLIP-seq
MIRT2135663	hsa-miR-3155	CLIP-seq
MIRT2135664	hsa-miR-3155b	CLIP-seq
MIRT2135665	hsa-miR-3182	CLIP-seq
MIRT2135666	hsa-miR-3187-5p	CLIP-seq
MIRT2135667	hsa-miR-3194-3p	CLIP-seq
MIRT2135668	hsa-miR-3617	CLIP-seq
MIRT2135669	hsa-miR-3674	CLIP-seq
MIRT2135670	hsa-miR-3677-5p	CLIP-seq
MIRT2135671	hsa-miR-3686	CLIP-seq
MIRT2135672	hsa-miR-3691-3p	CLIP-seq
MIRT2135673	hsa-miR-378g	CLIP-seq
MIRT2135674	hsa-miR-4297	CLIP-seq
MIRT2135675	hsa-miR-4314	CLIP-seq
MIRT2135676	hsa-miR-4437	CLIP-seq
MIRT1452912	hsa-miR-4451	CLIP-seq
MIRT2135677	hsa-miR-4486	CLIP-seq
MIRT2135678	hsa-miR-4659a-3p	CLIP-seq
MIRT2135679	hsa-miR-4659b-3p	CLIP-seq
MIRT2135680	hsa-miR-4674	CLIP-seq
MIRT1452914	hsa-miR-4691-5p	CLIP-seq
MIRT2135681	hsa-miR-4722-3p	CLIP-seq
MIRT2135682	hsa-miR-4726-3p	CLIP-seq
MIRT2135683	hsa-miR-4742-3p	CLIP-seq
MIRT2135684	hsa-miR-4778-3p	CLIP-seq
MIRT2135685	hsa-miR-4782-5p	CLIP-seq
MIRT2135686	hsa-miR-484	CLIP-seq
MIRT2135687	hsa-miR-516b	CLIP-seq
MIRT2135688	hsa-miR-558	CLIP-seq
MIRT2135689	hsa-miR-561	CLIP-seq
MIRT2135690	hsa-miR-612	CLIP-seq
MIRT2135691	hsa-miR-641	CLIP-seq
MIRT2135692	hsa-miR-760	CLIP-seq
MIRT2135693	hsa-miR-767-3p	CLIP-seq
MIRT2135694	hsa-miR-875-3p	CLIP-seq
MIRT2356867	hsa-miR-124	CLIP-seq
MIRT2356868	hsa-miR-1297	CLIP-seq
MIRT2356869	hsa-miR-148a	CLIP-seq
MIRT2356870	hsa-miR-148b	CLIP-seq
MIRT2356871	hsa-miR-152	CLIP-seq
MIRT1452899	hsa-miR-1915	CLIP-seq
MIRT2135662	hsa-miR-1972	CLIP-seq
MIRT2356872	hsa-miR-22	CLIP-seq
MIRT2356873	hsa-miR-24	CLIP-seq
MIRT2356874	hsa-miR-26a	CLIP-seq
MIRT2356875	hsa-miR-26b	CLIP-seq
MIRT2356876	hsa-miR-3169	CLIP-seq
MIRT2356877	hsa-miR-4254	CLIP-seq
MIRT2356878	hsa-miR-4465	CLIP-seq
MIRT2356879	hsa-miR-4519	CLIP-seq
MIRT1452914	hsa-miR-4691-5p	CLIP-seq
MIRT2356880	hsa-miR-506	CLIP-seq
MIRT2356881	hsa-miR-548an	CLIP-seq
MIRT2135688	hsa-miR-558	CLIP-seq
MIRT2650248	hsa-miR-4269	CLIP-seq
MIRT2650249	hsa-miR-4645-5p	CLIP-seq
MIRT2650250	hsa-miR-4673	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	27498865
GO:0004842	Function	Ubiquitin-protein transferase activity	IEA
GO:0005515	Function	Protein binding	IPI	16904669
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	18248090
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010468	Process	Regulation of gene expression	IBA
GO:0016567	Process	Protein ubiquitination	IDA	27498865
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	27498865
GO:0032897	Process	Negative regulation of viral transcription	IBA
GO:0032897	Process	Negative regulation of viral transcription	IDA	18248090
GO:0032897	Process	Negative regulation of viral transcription	IEA
GO:0044790	Process	Suppression of viral release by host	IBA
GO:0044790	Process	Suppression of viral release by host	IDA	18248090
GO:0044790	Process	Suppression of viral release by host	IEA
GO:0044790	Process	Suppression of viral release by host	IMP	18248090
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	IMP	18248090
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0046597	Process	Host-mediated suppression of symbiont invasion	IBA
GO:0046597	Process	Host-mediated suppression of symbiont invasion	IEA
GO:0046597	Process	Host-mediated suppression of symbiont invasion	IMP	18248090
GO:0046598	Process	Positive regulation of viral entry into host cell	IEA
GO:0046598	Process	Positive regulation of viral entry into host cell	IMP	18248090
GO:0046872	Function	Metal ion binding	IEA
GO:0050768	Process	Negative regulation of neurogenesis	IEA
GO:0051607	Process	Defense response to virus	IEA
GO:0051865	Process	Protein autoubiquitination	IDA	27498865
GO:0051865	Process	Protein autoubiquitination	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0140972	Process	Negative regulation of AIM2 inflammasome complex assembly	IDA	27498865

Other IDs

• MIM: 607868
• HGNC: 16281
• e!Ensembl: ENSG00000154370

Protein

• UniProt ID: Q96F44
• Protein name: E3 ubiquitin-protein ligase TRIM11 (EC 2.3.2.27) (Protein BIA1) (RING finger protein 92) (Tripartite motif-containing protein 11)
• Protein function: E3 ubiquitin-protein ligase that promotes the degradation of insoluble ubiquitinated proteins, including insoluble PAX6, poly-Gln repeat expanded HTT and poly-Ala repeat expanded ARX (By similarity). Mediates PAX6 ubiquitination leading to prote
• PDB: 7QS1
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15227	zf-C3HC4_4	16 → 56		Domain
  PF00643	zf-B_box	87 → 128	B-box zinc finger	Domain
  PF13765	PRY	289 → 337	SPRY-associated domain	Family
  PF00622	SPRY	341 → 451	SPRY domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. {ECO:0000305|PubMed:16904669}.
• Sequence:

  MAAPDLSTNLQEEATCAICLDYFTDPVMTDCGHNFCRECIRRCWGQPEGPYACPECRELS
  PQRNLRPNRPLAKMAEMARRLHPPSPVPQGVCPAHREPLAAFCGDELRLLCAACERSGEH
  WAHRVRPLQDAAEDLKAKLEKSLEHLRKQMQDALLFQAQADETCVLWQKMVESQRQNVLG
  EFERLRRLLAEEEQQLLQRLEEEELEVLPRLREGAAHLGQQSAHLAELIAELEGRCQLPA
  LGLLQDIKDALRRVQDVKLQPPEVVPMELRTVCRVPGLVETLRRFRGDVTLDPDTANPEL
  ILSEDRRSVQRGDLRQALPDSPERFDPGPCVLGQERFTSGRHYWEVEVGDRTSWALGVCR
  ENVNRKEKGELSAGNGFWILVFLGSYYNSSERALAPLRDPPRRVGIFLDYEAGHLSFYSA
  TDGSLLFIFPEIPFSGTLRPLFSPLSSSPTPMTICRPKGGSGDTLAPQ

• Sequence length: 468

Pathways

Reactome:

Antigen processing: Ubiquitination & Proteasome degradation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
HEPATOCELLULAR CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROGRESSIVE SUPRANUCLEAR PALSY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31598402		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30816511		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30816511, 31388304		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	32599554	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	27329103, 27888625, 28065743, 30816511, 31598402		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33173411	Associate	★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	31719797		★☆☆☆☆ Found in Text Mining only
Clear Cell Sarcoma of Soft Tissue	Sarcoma	BEFREE	31276279		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	27888625		★☆☆☆☆ Found in Text Mining only
Congenital central hypoventilation	Congenital Central Hypoventilation	BEFREE	22307522		★☆☆☆☆ Found in Text Mining only
Corticobasal Degeneration	Corticobasal degeneration	Pubtator	31860007	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	31336052		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23178488		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23178488, 27329103		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27329103	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28065743, 28244856, 29190611		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	27329103	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	31786079		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	23178488, 27888625		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30816511, 31388304		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27329103, 27888625, 28065743, 30816511, 31598402		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30608062		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23178488		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	27888625		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	36376537	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27888625, 28065743, 29190611, 29581427, 31598402		★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	30066433		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Progressive supranuclear palsy	Progressive Supranuclear Palsy	GWASCAT_DG	30066433		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	30608062		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	30608062	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	33099959	Associate	★☆☆☆☆ Found in Text Mining only
Supranuclear Palsy Progressive	Progressive supranuclear palsy	Pubtator	30066433, 31860007, 32142177, 35384155, 39260141	Associate	★☆☆☆☆ Found in Text Mining only