Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8148
Gene name	TATA-box binding protein associated factor 15
Gene symbol	TAF15
Synonyms (NCBI Gene)	Npl3RBP56TAF2NTAFII68
Chromosome	17
Chromosome location	17q12
Summary	This gene encodes a member of the TET family of RNA-binding proteins. The encoded protein plays a role in RNA polymerase II gene transcription as a component of a distinct subset of multi-subunit transcription initiation factor TFIID complexes. Translocat

134

Show/Hide all (134)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021732	hsa-miR-132-3p	Microarray	17612493
MIRT025067	hsa-miR-181a-5p	Microarray	17612493
MIRT030412	hsa-miR-24-3p	Microarray	19748357
MIRT031463	hsa-miR-16-5p	Proteomics	18668040
MIRT048160	hsa-miR-196a-5p	CLASH	23622248
MIRT047604	hsa-miR-10a-5p	CLASH	23622248
MIRT046039	hsa-miR-125b-5p	CLASH	23622248
MIRT044517	hsa-miR-320a	CLASH	23622248
MIRT041143	hsa-miR-501-5p	CLASH	23622248
MIRT040091	hsa-miR-615-3p	CLASH	23622248
MIRT040091	hsa-miR-615-3p	CLASH	23622248
MIRT040091	hsa-miR-615-3p	CLASH	23622248
MIRT037061	hsa-miR-877-3p	CLASH	23622248
MIRT1409126	hsa-miR-1246	CLIP-seq
MIRT1409127	hsa-miR-1271	CLIP-seq
MIRT1409128	hsa-miR-132	CLIP-seq
MIRT1409129	hsa-miR-1323	CLIP-seq
MIRT1409130	hsa-miR-137	CLIP-seq
MIRT1409131	hsa-miR-15a	CLIP-seq
MIRT1409132	hsa-miR-15b	CLIP-seq
MIRT1409133	hsa-miR-16	CLIP-seq
MIRT1409134	hsa-miR-181a	CLIP-seq
MIRT1409135	hsa-miR-181b	CLIP-seq
MIRT1409136	hsa-miR-181c	CLIP-seq
MIRT1409137	hsa-miR-181d	CLIP-seq
MIRT1409138	hsa-miR-182	CLIP-seq
MIRT1409139	hsa-miR-195	CLIP-seq
MIRT1409140	hsa-miR-2110	CLIP-seq
MIRT1409141	hsa-miR-212	CLIP-seq
MIRT1409142	hsa-miR-214	CLIP-seq
MIRT1409143	hsa-miR-216a	CLIP-seq
MIRT1409144	hsa-miR-25	CLIP-seq
MIRT1409145	hsa-miR-296-3p	CLIP-seq
MIRT1409146	hsa-miR-3128	CLIP-seq
MIRT1409147	hsa-miR-3150a-3p	CLIP-seq
MIRT1409148	hsa-miR-3175	CLIP-seq
MIRT1409149	hsa-miR-32	CLIP-seq
MIRT1409150	hsa-miR-3619-5p	CLIP-seq
MIRT1409151	hsa-miR-363	CLIP-seq
MIRT1409152	hsa-miR-367	CLIP-seq
MIRT1409153	hsa-miR-3912	CLIP-seq
MIRT1409154	hsa-miR-3919	CLIP-seq
MIRT1409155	hsa-miR-3978	CLIP-seq
MIRT1409156	hsa-miR-424	CLIP-seq
MIRT1409157	hsa-miR-4261	CLIP-seq
MIRT1409158	hsa-miR-4262	CLIP-seq
MIRT1409159	hsa-miR-4434	CLIP-seq
MIRT1409160	hsa-miR-4509	CLIP-seq
MIRT1409161	hsa-miR-4516	CLIP-seq
MIRT1409162	hsa-miR-4668-3p	CLIP-seq
MIRT1409163	hsa-miR-4690-5p	CLIP-seq
MIRT1409164	hsa-miR-4716-3p	CLIP-seq
MIRT1409165	hsa-miR-4717-5p	CLIP-seq
MIRT1409166	hsa-miR-4720-5p	CLIP-seq
MIRT1409167	hsa-miR-4742-5p	CLIP-seq
MIRT1409168	hsa-miR-4756-3p	CLIP-seq
MIRT1409169	hsa-miR-4775	CLIP-seq
MIRT1409170	hsa-miR-4799-3p	CLIP-seq
MIRT1409171	hsa-miR-497	CLIP-seq
MIRT1409172	hsa-miR-520d-5p	CLIP-seq
MIRT1409173	hsa-miR-524-5p	CLIP-seq
MIRT1409174	hsa-miR-543	CLIP-seq
MIRT1409175	hsa-miR-548c-3p	CLIP-seq
MIRT1409176	hsa-miR-548o	CLIP-seq
MIRT1409177	hsa-miR-579	CLIP-seq
MIRT1409178	hsa-miR-625	CLIP-seq
MIRT1409179	hsa-miR-668	CLIP-seq
MIRT1409180	hsa-miR-761	CLIP-seq
MIRT1409181	hsa-miR-92a	CLIP-seq
MIRT1409182	hsa-miR-92b	CLIP-seq
MIRT1409183	hsa-miR-939	CLIP-seq
MIRT1409184	hsa-miR-96	CLIP-seq
MIRT1409129	hsa-miR-1323	CLIP-seq
MIRT1409131	hsa-miR-15a	CLIP-seq
MIRT1409132	hsa-miR-15b	CLIP-seq
MIRT1409133	hsa-miR-16	CLIP-seq
MIRT1409139	hsa-miR-195	CLIP-seq
MIRT1409142	hsa-miR-214	CLIP-seq
MIRT1409143	hsa-miR-216a	CLIP-seq
MIRT1409150	hsa-miR-3619-5p	CLIP-seq
MIRT1409156	hsa-miR-424	CLIP-seq
MIRT1409162	hsa-miR-4668-3p	CLIP-seq
MIRT1409163	hsa-miR-4690-5p	CLIP-seq
MIRT1409165	hsa-miR-4717-5p	CLIP-seq
MIRT1409167	hsa-miR-4742-5p	CLIP-seq
MIRT1409169	hsa-miR-4775	CLIP-seq
MIRT2122704	hsa-miR-4777-5p	CLIP-seq
MIRT1409171	hsa-miR-497	CLIP-seq
MIRT2122705	hsa-miR-518d-5p	CLIP-seq
MIRT2122706	hsa-miR-519b-5p	CLIP-seq
MIRT2122707	hsa-miR-519c-5p	CLIP-seq
MIRT2122708	hsa-miR-520c-5p	CLIP-seq
MIRT2122709	hsa-miR-526a	CLIP-seq
MIRT1409175	hsa-miR-548c-3p	CLIP-seq
MIRT1409176	hsa-miR-548o	CLIP-seq
MIRT1409179	hsa-miR-668	CLIP-seq
MIRT1409180	hsa-miR-761	CLIP-seq
MIRT1409126	hsa-miR-1246	CLIP-seq
MIRT1409127	hsa-miR-1271	CLIP-seq
MIRT1409129	hsa-miR-1323	CLIP-seq
MIRT1409131	hsa-miR-15a	CLIP-seq
MIRT1409132	hsa-miR-15b	CLIP-seq
MIRT1409133	hsa-miR-16	CLIP-seq
MIRT1409134	hsa-miR-181a	CLIP-seq
MIRT1409135	hsa-miR-181b	CLIP-seq
MIRT1409136	hsa-miR-181c	CLIP-seq
MIRT1409137	hsa-miR-181d	CLIP-seq
MIRT1409138	hsa-miR-182	CLIP-seq
MIRT1409139	hsa-miR-195	CLIP-seq
MIRT1409142	hsa-miR-214	CLIP-seq
MIRT1409146	hsa-miR-3128	CLIP-seq
MIRT1409150	hsa-miR-3619-5p	CLIP-seq
MIRT1409153	hsa-miR-3912	CLIP-seq
MIRT1409154	hsa-miR-3919	CLIP-seq
MIRT1409156	hsa-miR-424	CLIP-seq
MIRT1409158	hsa-miR-4262	CLIP-seq
MIRT1409162	hsa-miR-4668-3p	CLIP-seq
MIRT1409163	hsa-miR-4690-5p	CLIP-seq
MIRT1409165	hsa-miR-4717-5p	CLIP-seq
MIRT1409166	hsa-miR-4720-5p	CLIP-seq
MIRT1409167	hsa-miR-4742-5p	CLIP-seq
MIRT1409168	hsa-miR-4756-3p	CLIP-seq
MIRT1409169	hsa-miR-4775	CLIP-seq
MIRT1409170	hsa-miR-4799-3p	CLIP-seq
MIRT1409171	hsa-miR-497	CLIP-seq
MIRT1409172	hsa-miR-520d-5p	CLIP-seq
MIRT1409173	hsa-miR-524-5p	CLIP-seq
MIRT1409174	hsa-miR-543	CLIP-seq
MIRT1409175	hsa-miR-548c-3p	CLIP-seq
MIRT1409176	hsa-miR-548o	CLIP-seq
MIRT1409177	hsa-miR-579	CLIP-seq
MIRT1409179	hsa-miR-668	CLIP-seq
MIRT1409180	hsa-miR-761	CLIP-seq
MIRT1409184	hsa-miR-96	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003712	Function	Transcription coregulator activity	IBA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IDA	27378374
GO:0003723	Function	RNA binding	IEA
GO:0003730	Function	MRNA 3'-UTR binding	IEA
GO:0005515	Function	Protein binding	IPI	18509338, 19124016, 21988832, 23975937, 27460707, 35271311
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	19124016
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA	19124016
GO:0005737	Component	Cytoplasm	IDA	19124016
GO:0005737	Component	Cytoplasm	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008380	Process	RNA splicing	IEA
GO:0010467	Process	Gene expression	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	TAS	19124016
GO:0046872	Function	Metal ion binding	IEA
GO:0048255	Process	MRNA stabilization	IDA	27378374

MIM	HGNC	e!Ensembl
601574	11547	ENSG00000270647

Q92804

Protein name

TATA-binding protein-associated factor 2N (68 kDa TATA-binding protein-associated factor) (TAF(II)68) (TAFII68) (RNA-binding protein 56)

Protein function

RNA and ssDNA-binding protein that may play specific roles during transcription initiation at distinct promoters. Binds to ssRNA containing the consensus sequence 5'-AGGUAA-3' (PubMed:21256132). Can enter the preinitiation complex together with

PDB

2MMY , 8ONS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00076	RRM_1	236 → 314	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF00641	zf-RanBP	354 → 385	Zn-finger in Ran binding protein and others	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Observed in all fetal and adult tissues.

Sequence

MSDSGSYGQSGGEQQSYSTYGNPGSQGYGQASQSYSGYGQTTDSSYGQNYSGYSSYGQSQ
SGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSYDQPDYGQQDSYDQQS
GYDQHQGSYDEQSNYDQQHDSYSQNQQSYHSQRENYSHHTQDDRRDVSRYGEDNRGYGGS
QGGGRGRGGYDKDGRGPMTGSSGGDRGGFKNFGGHRDYGPRTDADSESDNSDNNTIFVQG
LGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLYTDKDTGKPKGEATVSFDDPPSAKAAI
DWFDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGYRGRGGFQGRGGDPKSGDWVC
PNPSCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGYGG
DRSGGGYGGDRSSGGGYSGDRSGGGYGGDRSGGGYGGDRGGGYGGDRGGGYGGDRGGGYG
GDRGGYGGDRGGGYGGDRGGYGGDRGGYGGDRGGYGGDRGGYGGDRSRGGYGGDRGGGSG
YGGDRSGGYGGDRSGGGYGGDRGGGYGGDRGGYGGKMGGRNDYRNDQRNRPY

Sequence length

592

Interactions

View interactions

	KEGG		Reactome
	Basal transcription factors Transcriptional misregulation in cancer		RNA Polymerase II Pre-transcription Events Regulation of TP53 Activity through Phosphorylation RNA Polymerase II Promoter Escape RNA Polymerase II Transcription Pre-Initiation And Promoter Opening RNA Polymerase II Transcription Initiation RNA Polymerase II Transcription Initiation And Promoter Clearance

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (20)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS	—	ClinGen, Disgenet, GWAS catalog, Orphanet ClinGen, Disgenet, GWAS catalog, Orphanet ClinGen, Disgenet, GWAS catalog, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHONDROSARCOMA, EXTRASKELETAL MYXOID	—	CTD, HPO CTD, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EXTRASKELETAL MYXOID CHONDROSARCOMA	—	ClinVar, Orphanet ClinVar, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOSARCOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TAF15-related disorder	Likely benign; Benign; Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (64)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute leukemia	Leukemia	BEFREE	12359745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	21504714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	ORPHANET_DG	21438137		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic lateral sclerosis	Amyotrophic Lateral Sclerosis	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	21856723, 22065782, 22445064, 22454397, 23416048, 24011641, 27311318, 27378374, 28389532, 29425503, 30209068, 30339961		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	23755159, 26004182, 35643629, 37722062, 38492239	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	GENOMICS_ENGLAND_DG	26601740		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	BEFREE	21438137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	BEFREE	21344536, 21438137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	28291257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	28291257	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34908514, 36895010	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22081015	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	32871048	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	10602519, 31020999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	31020999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma Extraskeletal Myxoid	Extraskeletal myxoid chondrosarcoma	Pubtator	24508382, 31020999, 36948401	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	27607436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	12359745, 18320585, 22842875, 24899704, 26227957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Extraskeletal Myxoid Chondrosarcoma	Extraskeletal Myxoid Chondrosarcoma	BEFREE	10537274, 10895826, 11679947, 12378528, 15188455, 28383167, 31020999		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Extraskeletal Myxoid Chondrosarcoma	Extraskeletal Myxoid Chondrosarcoma	ORPHANET_DG	18330903		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Extraskeletal myxoid chondrosarcoma	Extraskeletal Myxoid Chondrosarcoma	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Extraskeletal Myxoid Chondrosarcoma	Extraskeletal Myxoid Chondrosarcoma	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Frontotemporal dementia	Frontotemporal dementia	BEFREE	22445064, 30209068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	22261247, 22842875, 24011641, 27903134, 30755280		★★★★★ ★☆☆☆☆ Found in Text Mining only
FRONTOTEMPORAL LOBAR DEGENERATION WITH TDP43 INCLUSIONS, GRN-RELATED	Frontotemporal lobar degeneration with Tdp43 inclusions	BEFREE	22445064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	21364753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngospasm	Laryngospasm	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	12359745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	18620564	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	19426707, 27607436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	12359745		★★★★★ ★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	21344536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma, Myxoid	liposarcoma	BEFREE	26865464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	30398641	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	21364753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12359745, 18850010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mixed phenotype acute leukemia	Mixed Phenotype Leukemia	BEFREE	27607436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood swings	Mood swings	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor neuron disease	Pubtator	22081015	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myxoid/Round Cell Liposarcoma	Myxoid Liposarcoma	BEFREE	26865464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	37257820	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10602520, 18850010, 24746215		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	27415968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	25375143, 35643629, 38492239	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	27311318, 27903134, 28453628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	39953608	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	CTD_human_DG	14767549		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pick Disease of the Brain	Pica	BEFREE	30209068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	30150451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	21504714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prion Diseases	Prion disease	Pubtator	35643629	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	10602519, 21344536, 23128393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	18620564, 35182012	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	38492239	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	31374203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	30931936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	21364753		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	37037864	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

TAF15 (TATA-box binding protein associated factor 15)