Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8128
Gene name	ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2
Gene symbol	ST8SIA2
Synonyms (NCBI Gene)	HsT19690SIAT8-BSIAT8BST8SIA-IIST8SiaIISTX
Chromosome	15
Chromosome location	15q26.1
Summary	The protein encoded by this gene is a type II membrane protein that is thought to catalyze the transfer of sialic acid from CMP-sialic acid to N-linked oligosaccharides and glycoproteins. The encoded protein may be found in the Golgi apparatus and may be

Show/Hide all (97)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029111	hsa-miR-26b-5p	Microarray	19088304
MIRT1393961	hsa-miR-1207-5p	CLIP-seq
MIRT1393962	hsa-miR-1299	CLIP-seq
MIRT1393963	hsa-miR-149	CLIP-seq
MIRT1393964	hsa-miR-1908	CLIP-seq
MIRT1393965	hsa-miR-3064-5p	CLIP-seq
MIRT1393966	hsa-miR-3143	CLIP-seq
MIRT1393967	hsa-miR-3922-5p	CLIP-seq
MIRT1393968	hsa-miR-4274	CLIP-seq
MIRT1393969	hsa-miR-4505	CLIP-seq
MIRT1393970	hsa-miR-4533	CLIP-seq
MIRT1393971	hsa-miR-4747-5p	CLIP-seq
MIRT1393972	hsa-miR-4763-3p	CLIP-seq
MIRT1393973	hsa-miR-4782-5p	CLIP-seq
MIRT1393974	hsa-miR-4790-3p	CLIP-seq
MIRT1393975	hsa-miR-4794	CLIP-seq
MIRT1393976	hsa-miR-494	CLIP-seq
MIRT1393977	hsa-miR-514	CLIP-seq
MIRT1393978	hsa-miR-514b-3p	CLIP-seq
MIRT1393979	hsa-miR-516b	CLIP-seq
MIRT1393980	hsa-miR-518a-5p	CLIP-seq
MIRT1393981	hsa-miR-527	CLIP-seq
MIRT1393982	hsa-miR-543	CLIP-seq
MIRT1393983	hsa-miR-548a-5p	CLIP-seq
MIRT1393984	hsa-miR-548ab	CLIP-seq
MIRT1393985	hsa-miR-548ak	CLIP-seq
MIRT1393986	hsa-miR-548b-5p	CLIP-seq
MIRT1393987	hsa-miR-548c-5p	CLIP-seq
MIRT1393988	hsa-miR-548d-5p	CLIP-seq
MIRT1393989	hsa-miR-548h	CLIP-seq
MIRT1393990	hsa-miR-548i	CLIP-seq
MIRT1393991	hsa-miR-548j	CLIP-seq
MIRT1393992	hsa-miR-548w	CLIP-seq
MIRT1393993	hsa-miR-548y	CLIP-seq
MIRT1393994	hsa-miR-559	CLIP-seq
MIRT1393995	hsa-miR-604	CLIP-seq
MIRT1393996	hsa-miR-622	CLIP-seq
MIRT1393997	hsa-miR-642b	CLIP-seq
MIRT1393998	hsa-miR-647	CLIP-seq
MIRT1393999	hsa-miR-663	CLIP-seq
MIRT1394000	hsa-miR-802	CLIP-seq
MIRT1394001	hsa-miR-875-3p	CLIP-seq
MIRT2118264	hsa-miR-182	CLIP-seq
MIRT2118265	hsa-miR-31	CLIP-seq
MIRT2118266	hsa-miR-3135b	CLIP-seq
MIRT2118267	hsa-miR-4271	CLIP-seq
MIRT2118268	hsa-miR-4434	CLIP-seq
MIRT2118269	hsa-miR-4516	CLIP-seq
MIRT2118270	hsa-miR-4686	CLIP-seq
MIRT2118271	hsa-miR-4705	CLIP-seq
MIRT2118272	hsa-miR-4725-3p	CLIP-seq
MIRT1393971	hsa-miR-4747-5p	CLIP-seq
MIRT2118273	hsa-miR-498	CLIP-seq
MIRT2118274	hsa-miR-499a-5p	CLIP-seq
MIRT2118275	hsa-miR-625	CLIP-seq
MIRT1393961	hsa-miR-1207-5p	CLIP-seq
MIRT2340289	hsa-miR-122	CLIP-seq
MIRT1393964	hsa-miR-1908	CLIP-seq
MIRT2340290	hsa-miR-2116	CLIP-seq
MIRT2340291	hsa-miR-2467-3p	CLIP-seq
MIRT2340292	hsa-miR-28-5p	CLIP-seq
MIRT2340293	hsa-miR-296-3p	CLIP-seq
MIRT2340294	hsa-miR-3139	CLIP-seq
MIRT2340295	hsa-miR-331-3p	CLIP-seq
MIRT2340296	hsa-miR-342-5p	CLIP-seq
MIRT2340297	hsa-miR-3659	CLIP-seq
MIRT2340298	hsa-miR-3678-3p	CLIP-seq
MIRT2340299	hsa-miR-4255	CLIP-seq
MIRT2340300	hsa-miR-4302	CLIP-seq
MIRT2340301	hsa-miR-4450	CLIP-seq
MIRT2340302	hsa-miR-4456	CLIP-seq
MIRT1393969	hsa-miR-4505	CLIP-seq
MIRT2340303	hsa-miR-4508	CLIP-seq
MIRT2340304	hsa-miR-4664-5p	CLIP-seq
MIRT2340305	hsa-miR-4677-5p	CLIP-seq
MIRT2340306	hsa-miR-4697-3p	CLIP-seq
MIRT2340307	hsa-miR-4757-3p	CLIP-seq
MIRT1393972	hsa-miR-4763-3p	CLIP-seq
MIRT2340308	hsa-miR-486-3p	CLIP-seq
MIRT2340309	hsa-miR-491-5p	CLIP-seq
MIRT1393980	hsa-miR-518a-5p	CLIP-seq
MIRT1393981	hsa-miR-527	CLIP-seq
MIRT2340310	hsa-miR-541	CLIP-seq
MIRT2340311	hsa-miR-569	CLIP-seq
MIRT2340312	hsa-miR-578	CLIP-seq
MIRT2340313	hsa-miR-581	CLIP-seq
MIRT2340314	hsa-miR-582-3p	CLIP-seq
MIRT2340315	hsa-miR-654-5p	CLIP-seq
MIRT1393999	hsa-miR-663	CLIP-seq
MIRT2340316	hsa-miR-708	CLIP-seq
MIRT2395266	hsa-miR-125a-3p	CLIP-seq
MIRT2395267	hsa-miR-3202	CLIP-seq
MIRT2395268	hsa-miR-3934	CLIP-seq
MIRT2395269	hsa-miR-4265	CLIP-seq
MIRT2395270	hsa-miR-4296	CLIP-seq
MIRT2395271	hsa-miR-4322	CLIP-seq
MIRT2395272	hsa-miR-764	CLIP-seq

Show/Hide all (40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0000166	Function	Nucleotide binding	IEA
GO:0001574	Process	Ganglioside biosynthetic process	IDA	10766765
GO:0003828	Function	Alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity	IBA
GO:0003828	Function	Alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity	IDA	9774483, 10766765
GO:0003828	Function	Alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity	IEA
GO:0003828	Function	Alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity	TAS
GO:0005576	Component	Extracellular region	IDA	11744634
GO:0005576	Component	Extracellular region	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005769	Component	Early endosome	IEA
GO:0005794	Component	Golgi apparatus	IDA	9852130, 11744634
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005975	Process	Carbohydrate metabolic process	TAS	7559389
GO:0006486	Process	Protein glycosylation	IBA
GO:0006486	Process	Protein glycosylation	IDA	10766765
GO:0006486	Process	Protein glycosylation	IEA
GO:0006491	Process	N-glycan processing	IBA
GO:0006491	Process	N-glycan processing	IDA	10766765
GO:0007399	Process	Nervous system development	TAS	9054414
GO:0008373	Function	Sialyltransferase activity	IEA
GO:0009311	Process	Oligosaccharide metabolic process	IBA
GO:0009311	Process	Oligosaccharide metabolic process	IDA	10766765
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0033691	Function	Sialic acid binding	IC	10766765
GO:0036211	Process	Protein modification process	TAS	7559389
GO:0042220	Process	Response to cocaine	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0051965	Process	Positive regulation of synapse assembly	IEA
GO:0055037	Component	Recycling endosome	IEA
GO:0097503	Process	Sialylation	IDA	7559389, 9054414, 9774483, 10766765
GO:0097503	Process	Sialylation	IEA
GO:1990138	Process	Neuron projection extension	IEA

MIM	HGNC	e!Ensembl
602546	10870	ENSG00000140557

Q92186

Protein name

Alpha-2,8-sialyltransferase 8B (EC 2.4.3.-) (Sialyltransferase 8B) (SIAT8-B) (Sialyltransferase St8Sia II) (ST8SiaII) (Sialyltransferase X) (STX)

Protein function

Catalyzes the transfer of a sialic acid from a CMP-linked sialic acid donor onto a terminal alpha-2,3-, alpha-2,6-, or alpha-2,8-linked sialic acid of an N-linked glycan acceptor through alpha-2,8-linkages (Probable) (PubMed:10766765, PubMed:117

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00777	Glyco_transf_29	109 → 368	Glycosyltransferase family 29 (sialyltransferase)	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in fetal brain, kidney and heart and to a much lesser extent in adult heart and thymus. {ECO:0000269|PubMed:9054414}.

Sequence

MQLQFRSWMLAALTLLVVFLIFADISEIEEEIGNSGGRGTIRSAVNSLHSKSNRAEVVIN
GSSSPAVVDRSNESIKHNIQPASSKWRHNQTLSLRIRKQILKFLDAEKDISVLKGTLKPG
DIIHYIFDRDSTMNVSQNLYELLPRTSPLKNKHFGTCAIVGNSGVLLNSGCGQEIDAHSF
VIRCNLAPVQEYARDVGLKTDLVTMNPSVIQRAFEDLVNATWREKLLQRLHSLNGSILWI
PAFMARGGKERVEWVNELILKHHVNVRTAYPSLRLLHAVRGYWLTNKVHIKRPTTGLLMY
TLATRFCKQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQASPHTMPLEFKALKSLHE
QGALKLTVGQCDGAT

Sequence length

375

Interactions

View interactions

	Reactome
			Sialic acid metabolism NCAM1 interactions N-Glycan antennae elongation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GenCC Disgenet, GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL ALLERGIC RHINITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ST8SIA2-related disorder	Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (39)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	27565727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	GWASCAT_DG	25085501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	17113863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	24357335, 27105834, 27565727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	CTD_human_DG	20663923		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	20663923, 22693595, 24651862	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	BEFREE	22693595, 24651862, 31608978		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	17126533, 24651862, 25129258, 26418860, 28538701		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	22693595, 24651862, 26418860	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	24651862, 25129258		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	BEFREE	26418860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26530860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24255131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	19752028	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	12454157, 19752028	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Enteritis	Enteritis	BEFREE	12440197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	24357335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	33357046	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroenteritis	Gastroenteritis	BEFREE	15496393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	12454157	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	17029135, 26103973, 30934002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26530860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10850459, 30978569, 31755393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	34943806	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	27105834, 27565727, 31289315, 31608978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	22693595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood swings	Mood swings	BEFREE	29215920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10850459, 16450393, 22463390, 28716484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	16450393, 27565727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	10850459, 30978569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	24357335, 27565727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	28499450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	16229822, 16969366, 17126533, 22693595, 23354723, 24070986, 26418860, 27534376, 28538701, 28810663, 29353880, 30044798, 31455764, 31608978		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	16229822		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	16969366, 17126533, 22693595, 24057454, 24070986		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	22693595, 24651862, 26418860, 29353880, 30044798	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	23951351	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28582545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	9657756	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ST8SIA2 (ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2)