Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8125
Gene name	Acidic nuclear phosphoprotein 32 family member A
Gene symbol	ANP32A
Synonyms (NCBI Gene)	C15orf1HPPCnI1PP2ALANPMAPMPHAP1PHAPIPP32
Chromosome	15
Chromosome location	15q23

250

Show/Hide all (250)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006515	hsa-miR-21-5p	Luciferase reporter assayqRT-PCRWestern blot	21317927
MIRT006515	hsa-miR-21-5p	Luciferase reporter assayqRT-PCRWestern blot	21317927
MIRT006515	hsa-miR-21-5p	Luciferase reporter assayqRT-PCRWestern blot	21317927
MIRT006515	hsa-miR-21-5p	Luciferase reporter assayqRT-PCRWestern blot	21317927
MIRT023840	hsa-miR-1-3p	Proteomics	18668040
MIRT025972	hsa-miR-148a-3p	Sequencing	20371350
MIRT044480	hsa-miR-320a	CLASH	23622248
MIRT039733	hsa-miR-615-3p	CLASH	23622248
MIRT037263	hsa-miR-877-5p	CLASH	23622248
MIRT036598	hsa-miR-940	CLASH	23622248
MIRT716197	hsa-miR-4712-5p	HITS-CLIP	19536157
MIRT716196	hsa-miR-770-5p	HITS-CLIP	19536157
MIRT716195	hsa-miR-361-3p	HITS-CLIP	19536157
MIRT716194	hsa-miR-6887-3p	HITS-CLIP	19536157
MIRT716193	hsa-miR-6795-3p	HITS-CLIP	19536157
MIRT716192	hsa-miR-6892-3p	HITS-CLIP	19536157
MIRT716191	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT716190	hsa-miR-6826-3p	HITS-CLIP	19536157
MIRT562666	hsa-miR-203a-3p	PAR-CLIP	20371350
MIRT281863	hsa-miR-3163	PAR-CLIP	20371350
MIRT562665	hsa-miR-568	PAR-CLIP	20371350
MIRT562664	hsa-miR-374a-3p	PAR-CLIP	20371350
MIRT716197	hsa-miR-4712-5p	HITS-CLIP	19536157
MIRT716196	hsa-miR-770-5p	HITS-CLIP	19536157
MIRT716195	hsa-miR-361-3p	HITS-CLIP	19536157
MIRT716194	hsa-miR-6887-3p	HITS-CLIP	19536157
MIRT716193	hsa-miR-6795-3p	HITS-CLIP	19536157
MIRT716192	hsa-miR-6892-3p	HITS-CLIP	19536157
MIRT716191	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT716190	hsa-miR-6826-3p	HITS-CLIP	19536157
MIRT562666	hsa-miR-203a-3p	PAR-CLIP	20371350
MIRT281863	hsa-miR-3163	PAR-CLIP	20371350
MIRT562665	hsa-miR-568	PAR-CLIP	20371350
MIRT562664	hsa-miR-374a-3p	PAR-CLIP	20371350
MIRT785916	hsa-miR-1200	CLIP-seq
MIRT785917	hsa-miR-1305	CLIP-seq
MIRT785918	hsa-miR-132	CLIP-seq
MIRT785919	hsa-miR-1825	CLIP-seq
MIRT785920	hsa-miR-203	CLIP-seq
MIRT785921	hsa-miR-212	CLIP-seq
MIRT785922	hsa-miR-23a	CLIP-seq
MIRT785923	hsa-miR-23b	CLIP-seq
MIRT785924	hsa-miR-23c	CLIP-seq
MIRT785925	hsa-miR-3115	CLIP-seq
MIRT785926	hsa-miR-3177-5p	CLIP-seq
MIRT785927	hsa-miR-3201	CLIP-seq
MIRT785928	hsa-miR-340	CLIP-seq
MIRT785929	hsa-miR-34a	CLIP-seq
MIRT785930	hsa-miR-34c-5p	CLIP-seq
MIRT785931	hsa-miR-3607-5p	CLIP-seq
MIRT785932	hsa-miR-3973	CLIP-seq
MIRT785933	hsa-miR-4258	CLIP-seq
MIRT785934	hsa-miR-4324	CLIP-seq
MIRT785935	hsa-miR-449a	CLIP-seq
MIRT785936	hsa-miR-449b	CLIP-seq
MIRT785937	hsa-miR-4528	CLIP-seq
MIRT785938	hsa-miR-4682	CLIP-seq
MIRT785939	hsa-miR-4685-5p	CLIP-seq
MIRT785940	hsa-miR-4698	CLIP-seq
MIRT785941	hsa-miR-4699-3p	CLIP-seq
MIRT785942	hsa-miR-4762-5p	CLIP-seq
MIRT785943	hsa-miR-4791	CLIP-seq
MIRT785944	hsa-miR-5095	CLIP-seq
MIRT785945	hsa-miR-520d-5p	CLIP-seq
MIRT785946	hsa-miR-520g	CLIP-seq
MIRT785947	hsa-miR-520h	CLIP-seq
MIRT785948	hsa-miR-524-5p	CLIP-seq
MIRT785949	hsa-miR-543	CLIP-seq
MIRT785950	hsa-miR-544b	CLIP-seq
MIRT785951	hsa-miR-548a-3p	CLIP-seq
MIRT785952	hsa-miR-548ac	CLIP-seq
MIRT785953	hsa-miR-548ae	CLIP-seq
MIRT785954	hsa-miR-548aj	CLIP-seq
MIRT785955	hsa-miR-548am	CLIP-seq
MIRT785956	hsa-miR-548c-3p	CLIP-seq
MIRT785957	hsa-miR-548d-3p	CLIP-seq
MIRT785958	hsa-miR-548e	CLIP-seq
MIRT785959	hsa-miR-548f	CLIP-seq
MIRT785960	hsa-miR-548x	CLIP-seq
MIRT785961	hsa-miR-548z	CLIP-seq
MIRT785962	hsa-miR-555	CLIP-seq
MIRT785963	hsa-miR-561	CLIP-seq
MIRT785964	hsa-miR-607	CLIP-seq
MIRT785965	hsa-miR-888	CLIP-seq
MIRT1931853	hsa-miR-1	CLIP-seq
MIRT1931854	hsa-miR-1245b-3p	CLIP-seq
MIRT1931855	hsa-miR-1251	CLIP-seq
MIRT785917	hsa-miR-1305	CLIP-seq
MIRT785918	hsa-miR-132	CLIP-seq
MIRT1931856	hsa-miR-181a	CLIP-seq
MIRT1931857	hsa-miR-181b	CLIP-seq
MIRT1931858	hsa-miR-181c	CLIP-seq
MIRT1931859	hsa-miR-181d	CLIP-seq
MIRT1931860	hsa-miR-206	CLIP-seq
MIRT785921	hsa-miR-212	CLIP-seq
MIRT785925	hsa-miR-3115	CLIP-seq
MIRT1931861	hsa-miR-3126-5p	CLIP-seq
MIRT1931862	hsa-miR-3175	CLIP-seq
MIRT1931863	hsa-miR-3179	CLIP-seq
MIRT785927	hsa-miR-3201	CLIP-seq
MIRT1931864	hsa-miR-3611	CLIP-seq
MIRT1931865	hsa-miR-4262	CLIP-seq
MIRT785934	hsa-miR-4324	CLIP-seq
MIRT1931866	hsa-miR-4422	CLIP-seq
MIRT1931867	hsa-miR-4443	CLIP-seq
MIRT1931868	hsa-miR-4509	CLIP-seq
MIRT1931869	hsa-miR-4668-5p	CLIP-seq
MIRT1931870	hsa-miR-4677-3p	CLIP-seq
MIRT1931871	hsa-miR-4679	CLIP-seq
MIRT1931872	hsa-miR-4690-5p	CLIP-seq
MIRT1931873	hsa-miR-4716-3p	CLIP-seq
MIRT1931874	hsa-miR-4723-5p	CLIP-seq
MIRT1931875	hsa-miR-4744	CLIP-seq
MIRT785943	hsa-miR-4791	CLIP-seq
MIRT1931876	hsa-miR-4799-5p	CLIP-seq
MIRT1931877	hsa-miR-494	CLIP-seq
MIRT785951	hsa-miR-548a-3p	CLIP-seq
MIRT785952	hsa-miR-548ac	CLIP-seq
MIRT785953	hsa-miR-548ae	CLIP-seq
MIRT785954	hsa-miR-548aj	CLIP-seq
MIRT785955	hsa-miR-548am	CLIP-seq
MIRT785957	hsa-miR-548d-3p	CLIP-seq
MIRT785958	hsa-miR-548e	CLIP-seq
MIRT785959	hsa-miR-548f	CLIP-seq
MIRT785960	hsa-miR-548x	CLIP-seq
MIRT785961	hsa-miR-548z	CLIP-seq
MIRT785962	hsa-miR-555	CLIP-seq
MIRT1931878	hsa-miR-613	CLIP-seq
MIRT1931879	hsa-miR-625	CLIP-seq
MIRT1931853	hsa-miR-1	CLIP-seq
MIRT2172319	hsa-miR-103a	CLIP-seq
MIRT2172320	hsa-miR-105	CLIP-seq
MIRT2172321	hsa-miR-107	CLIP-seq
MIRT2172322	hsa-miR-1178	CLIP-seq
MIRT785916	hsa-miR-1200	CLIP-seq
MIRT1931855	hsa-miR-1251	CLIP-seq
MIRT785917	hsa-miR-1305	CLIP-seq
MIRT785918	hsa-miR-132	CLIP-seq
MIRT2172323	hsa-miR-146a	CLIP-seq
MIRT2172324	hsa-miR-146b-5p	CLIP-seq
MIRT2172325	hsa-miR-1470	CLIP-seq
MIRT2172326	hsa-miR-149	CLIP-seq
MIRT1931856	hsa-miR-181a	CLIP-seq
MIRT1931857	hsa-miR-181b	CLIP-seq
MIRT1931858	hsa-miR-181c	CLIP-seq
MIRT1931859	hsa-miR-181d	CLIP-seq
MIRT785919	hsa-miR-1825	CLIP-seq
MIRT2172327	hsa-miR-1973	CLIP-seq
MIRT1931860	hsa-miR-206	CLIP-seq
MIRT785921	hsa-miR-212	CLIP-seq
MIRT2172328	hsa-miR-2355-5p	CLIP-seq
MIRT2172329	hsa-miR-24	CLIP-seq
MIRT2172330	hsa-miR-3064-5p	CLIP-seq
MIRT785925	hsa-miR-3115	CLIP-seq
MIRT1931861	hsa-miR-3126-5p	CLIP-seq
MIRT2172331	hsa-miR-3145-5p	CLIP-seq
MIRT1931862	hsa-miR-3175	CLIP-seq
MIRT785926	hsa-miR-3177-5p	CLIP-seq
MIRT785927	hsa-miR-3201	CLIP-seq
MIRT2172332	hsa-miR-326	CLIP-seq
MIRT2172333	hsa-miR-330-5p	CLIP-seq
MIRT2172334	hsa-miR-335	CLIP-seq
MIRT2172335	hsa-miR-3591-5p	CLIP-seq
MIRT785931	hsa-miR-3607-5p	CLIP-seq
MIRT2172336	hsa-miR-3692	CLIP-seq
MIRT2172337	hsa-miR-3925-5p	CLIP-seq
MIRT2172338	hsa-miR-3942-3p	CLIP-seq
MIRT2172339	hsa-miR-423-3p	CLIP-seq
MIRT2172340	hsa-miR-4251	CLIP-seq
MIRT1931865	hsa-miR-4262	CLIP-seq
MIRT2172341	hsa-miR-4284	CLIP-seq
MIRT785934	hsa-miR-4324	CLIP-seq
MIRT2172342	hsa-miR-4436b-5p	CLIP-seq
MIRT1931867	hsa-miR-4443	CLIP-seq
MIRT2172343	hsa-miR-4496	CLIP-seq
MIRT2172344	hsa-miR-4650-5p	CLIP-seq
MIRT2172345	hsa-miR-4667-3p	CLIP-seq
MIRT785938	hsa-miR-4682	CLIP-seq
MIRT1931872	hsa-miR-4690-5p	CLIP-seq
MIRT2172346	hsa-miR-4693-3p	CLIP-seq
MIRT1931874	hsa-miR-4723-5p	CLIP-seq
MIRT785942	hsa-miR-4762-5p	CLIP-seq
MIRT785943	hsa-miR-4791	CLIP-seq
MIRT2172347	hsa-miR-4794	CLIP-seq
MIRT2172348	hsa-miR-486-3p	CLIP-seq
MIRT2172349	hsa-miR-486-5p	CLIP-seq
MIRT2172350	hsa-miR-539	CLIP-seq
MIRT785949	hsa-miR-543	CLIP-seq
MIRT785950	hsa-miR-544b	CLIP-seq
MIRT785952	hsa-miR-548ac	CLIP-seq
MIRT785953	hsa-miR-548ae	CLIP-seq
MIRT785954	hsa-miR-548aj	CLIP-seq
MIRT785955	hsa-miR-548am	CLIP-seq
MIRT785957	hsa-miR-548d-3p	CLIP-seq
MIRT2172351	hsa-miR-548q	CLIP-seq
MIRT785960	hsa-miR-548x	CLIP-seq
MIRT785961	hsa-miR-548z	CLIP-seq
MIRT785962	hsa-miR-555	CLIP-seq
MIRT2172352	hsa-miR-596	CLIP-seq
MIRT1931878	hsa-miR-613	CLIP-seq
MIRT2172353	hsa-miR-648	CLIP-seq
MIRT2172354	hsa-miR-649	CLIP-seq
MIRT2172355	hsa-miR-802	CLIP-seq
MIRT2172356	hsa-miR-873	CLIP-seq
MIRT2426327	hsa-miR-2116	CLIP-seq
MIRT2426328	hsa-miR-4677-5p	CLIP-seq
MIRT785951	hsa-miR-548a-3p	CLIP-seq
MIRT785953	hsa-miR-548ae	CLIP-seq
MIRT785954	hsa-miR-548aj	CLIP-seq
MIRT785955	hsa-miR-548am	CLIP-seq
MIRT785958	hsa-miR-548e	CLIP-seq
MIRT785959	hsa-miR-548f	CLIP-seq
MIRT2172351	hsa-miR-548q	CLIP-seq
MIRT785960	hsa-miR-548x	CLIP-seq
MIRT2426329	hsa-miR-582-3p	CLIP-seq
MIRT2172323	hsa-miR-146a	CLIP-seq
MIRT2172324	hsa-miR-146b-5p	CLIP-seq
MIRT2172331	hsa-miR-3145-5p	CLIP-seq
MIRT2475124	hsa-miR-3153	CLIP-seq
MIRT2475125	hsa-miR-3190	CLIP-seq
MIRT2475126	hsa-miR-3614-3p	CLIP-seq
MIRT2172337	hsa-miR-3925-5p	CLIP-seq
MIRT2475127	hsa-miR-4297	CLIP-seq
MIRT2475128	hsa-miR-4491	CLIP-seq
MIRT2172343	hsa-miR-4496	CLIP-seq
MIRT2475129	hsa-miR-4657	CLIP-seq
MIRT2475130	hsa-miR-4666-5p	CLIP-seq
MIRT1931869	hsa-miR-4668-5p	CLIP-seq
MIRT2475131	hsa-miR-4691-3p	CLIP-seq
MIRT2475132	hsa-miR-4768-5p	CLIP-seq
MIRT2475133	hsa-miR-4786-5p	CLIP-seq
MIRT2475134	hsa-miR-7	CLIP-seq
MIRT2475135	hsa-miR-769-5p	CLIP-seq
MIRT2172323	hsa-miR-146a	CLIP-seq
MIRT2172324	hsa-miR-146b-5p	CLIP-seq
MIRT2475124	hsa-miR-3153	CLIP-seq
MIRT2475125	hsa-miR-3190	CLIP-seq
MIRT2475126	hsa-miR-3614-3p	CLIP-seq
MIRT2172337	hsa-miR-3925-5p	CLIP-seq
MIRT2475127	hsa-miR-4297	CLIP-seq
MIRT2475128	hsa-miR-4491	CLIP-seq
MIRT2172343	hsa-miR-4496	CLIP-seq
MIRT2475129	hsa-miR-4657	CLIP-seq
MIRT2475130	hsa-miR-4666-5p	CLIP-seq
MIRT1931869	hsa-miR-4668-5p	CLIP-seq
MIRT2475131	hsa-miR-4691-3p	CLIP-seq
MIRT2475132	hsa-miR-4768-5p	CLIP-seq
MIRT2475133	hsa-miR-4786-5p	CLIP-seq
MIRT2475134	hsa-miR-7	CLIP-seq
MIRT2475135	hsa-miR-769-5p	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22681889
GO:0005515	Function	Protein binding	IPI	16169070, 17557114, 21806989, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	11555662, 11729309
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	11729309, 12524539
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	8192856
GO:0005783	Component	Endoplasmic reticulum	IDA	11555662, 12524539
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0006913	Process	Nucleocytoplasmic transport	IBA
GO:0006913	Process	Nucleocytoplasmic transport	IDA	11729309
GO:0006913	Process	Nucleocytoplasmic transport	NAS	11555662
GO:0035556	Process	Intracellular signal transduction	TAS	8192856
GO:0042393	Function	Histone binding	IBA
GO:0042981	Process	Regulation of apoptotic process	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	11555662, 12524539

MIM	HGNC	e!Ensembl
600832	13233	ENSG00000140350

P39687

Protein name

Acidic leucine-rich nuclear phosphoprotein 32 family member A (Acidic nuclear phosphoprotein pp32) (pp32) (Leucine-rich acidic nuclear protein) (LANP) (Mapmodulin) (Potent heat-stable protein phosphatase 2A inhibitor I1PP2A) (Putative HLA-DR-associated pr

Protein function

Multifunctional protein that is involved in the regulation of many processes including tumor suppression, apoptosis, cell cycle progression or transcription (PubMed:10400610, PubMed:11360199, PubMed:16341127, PubMed:18439902). Promotes apoptosis

PDB

2JE0 , 2JE1 , 4XOS , 6XZQ , 8RMR , 8RN0 , 8RNA , 8RNB , 8RNC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14580	LRR_9	33 → 166		Repeat

Tissue specificity

TISSUE SPECIFICITY: Expressed in all tissues tested. Highly expressed in kidney and skeletal muscle, moderate levels of expression in brain, placenta and pancreas, and weakly expressed in lung. Found in all regions of the brain examined (amygdala, caudate

Sequence

MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANL
PKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDL
FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYD
EDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKRE
PEDEGEDDD

Sequence length

249

Interactions

View interactions

	Reactome
			HuR (ELAVL1) binds and stabilizes mRNA

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER FAILURE, ACUTE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (52)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	14695340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	27602772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	11360199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	35283023	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	28472990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11678310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17567741, 17906614, 36140725	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11678310, 20683644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	20066738	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35280441	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	17906614	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	28473768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	35283023	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	35283023	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	25944804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28731192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	25944804		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Degenerative polyarthritis	Arthritis	BEFREE	19565487, 31037830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	36477008	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	37509196	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29667783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	29667783	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	20066738	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	26697860, 28473768, 29782322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29467488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	26918356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20683644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17962813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21152064	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26918356	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11678310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	26918356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21152064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10086381, 11360199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10086381, 18602748, 21152064, 28731192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	26918356	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10086381, 11360199, 11678310, 14695340, 15060138, 19121999, 19565487, 20683644, 21152064, 21317927, 26918356, 28062797, 28731192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	17567741	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	17557114, 29782322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	19565487	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis Hip	Osteoarthritis	Pubtator	19565487	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	19565487	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	BEFREE	19565487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21152064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	17906614	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21152064	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	17906614	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10086381, 11360199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 1	Spinocerebellar Ataxia	BEFREE	15060138, 17557114, 23630944, 9353121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxias	Spinocerebellar ataxia	Pubtator	17567741	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	26918356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26918356	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ANP32A (acidic nuclear phosphoprotein 32 family member A)