CALR (calreticulin)

Gene

• Entrez ID: 811
• Gene name: Calreticulin
• Gene symbol: CALR
• Synonyms (NCBI Gene): CALR1, CRT, HEL-S-99n, RO, SSA, cC1qR
• Chromosome: 19
• Chromosome location: 19p13.13
• Summary: Calreticulin is a highly conserved chaperone protein which resides primarily in the endoplasmic reticulum, and is involved in a variety of cellular processes, among them, cell adhesion. Additionally, it functions in protein folding quality control and cal

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1555760738	CTTAAGGAGGAGGAAGAAGACAAGAAACGCAAAGAGGAGGAGGAGGCAGAGG>-	Pathogenic	Frameshift variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022337	hsa-miR-124-3p	Microarray	18668037
MIRT023227	hsa-miR-122-5p	Proteomics	21750653
MIRT023576	hsa-miR-1-3p	Microarray	18668037
MIRT031457	hsa-miR-16-5p	Proteomics	18668040
MIRT045548	hsa-miR-149-5p	CLASH	23622248
MIRT044537	hsa-miR-320a	CLASH	23622248
MIRT042481	hsa-miR-423-3p	CLASH	23622248
MIRT042481	hsa-miR-423-3p	CLASH	23622248
MIRT723641	hsa-miR-6771-3p	HITS-CLIP	19536157
MIRT081258	hsa-miR-3662	PAR-CLIP	20371350
MIRT081257	hsa-miR-3646	PAR-CLIP	20371350
MIRT081250	hsa-miR-148a-5p	PAR-CLIP	20371350
MIRT081259	hsa-miR-6849-3p	PAR-CLIP	20371350
MIRT081253	hsa-miR-875-3p	PAR-CLIP	20371350
MIRT081254	hsa-miR-1254	PAR-CLIP	20371350
MIRT081255	hsa-miR-3116	PAR-CLIP	20371350
MIRT081256	hsa-miR-3148	PAR-CLIP	20371350
MIRT512182	hsa-miR-6124	PAR-CLIP	20371350
MIRT081252	hsa-miR-516a-5p	PAR-CLIP	20371350
MIRT081258	hsa-miR-3662	PAR-CLIP	20371350
MIRT081257	hsa-miR-3646	PAR-CLIP	20371350
MIRT081250	hsa-miR-148a-5p	PAR-CLIP	20371350
MIRT081259	hsa-miR-6849-3p	PAR-CLIP	20371350
MIRT081253	hsa-miR-875-3p	PAR-CLIP	20371350
MIRT081254	hsa-miR-1254	PAR-CLIP	20371350
MIRT081255	hsa-miR-3116	PAR-CLIP	20371350
MIRT081256	hsa-miR-3148	PAR-CLIP	20371350
MIRT512182	hsa-miR-6124	PAR-CLIP	20371350
MIRT081252	hsa-miR-516a-5p	PAR-CLIP	20371350
MIRT081258	hsa-miR-3662	PAR-CLIP	20371350
MIRT081257	hsa-miR-3646	PAR-CLIP	20371350
MIRT081250	hsa-miR-148a-5p	PAR-CLIP	20371350
MIRT081259	hsa-miR-6849-3p	PAR-CLIP	20371350
MIRT081253	hsa-miR-875-3p	PAR-CLIP	20371350
MIRT081254	hsa-miR-1254	PAR-CLIP	20371350
MIRT081255	hsa-miR-3116	PAR-CLIP	20371350
MIRT081256	hsa-miR-3148	PAR-CLIP	20371350
MIRT512182	hsa-miR-6124	PAR-CLIP	20371350
MIRT081252	hsa-miR-516a-5p	PAR-CLIP	20371350
MIRT081258	hsa-miR-3662	PAR-CLIP	20371350
MIRT081257	hsa-miR-3646	PAR-CLIP	20371350
MIRT081250	hsa-miR-148a-5p	PAR-CLIP	20371350
MIRT081259	hsa-miR-6849-3p	PAR-CLIP	20371350
MIRT081253	hsa-miR-875-3p	PAR-CLIP	20371350
MIRT081254	hsa-miR-1254	PAR-CLIP	20371350
MIRT081255	hsa-miR-3116	PAR-CLIP	20371350
MIRT081256	hsa-miR-3148	PAR-CLIP	20371350
MIRT512182	hsa-miR-6124	PAR-CLIP	20371350
MIRT081252	hsa-miR-516a-5p	PAR-CLIP	20371350
MIRT081258	hsa-miR-3662	PAR-CLIP	21572407
MIRT081257	hsa-miR-3646	PAR-CLIP	21572407
MIRT081250	hsa-miR-148a-5p	PAR-CLIP	21572407
MIRT081259	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT558968	hsa-miR-6716-3p	PAR-CLIP	21572407
MIRT081253	hsa-miR-875-3p	PAR-CLIP	21572407
MIRT081254	hsa-miR-1254	PAR-CLIP	21572407
MIRT081255	hsa-miR-3116	PAR-CLIP	21572407
MIRT081256	hsa-miR-3148	PAR-CLIP	21572407
MIRT512182	hsa-miR-6124	PAR-CLIP	21572407
MIRT081252	hsa-miR-516a-5p	PAR-CLIP	21572407
MIRT081258	hsa-miR-3662	PAR-CLIP	21572407
MIRT081257	hsa-miR-3646	PAR-CLIP	21572407
MIRT081250	hsa-miR-148a-5p	PAR-CLIP	21572407
MIRT081259	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT081253	hsa-miR-875-3p	PAR-CLIP	21572407
MIRT081254	hsa-miR-1254	PAR-CLIP	21572407
MIRT081255	hsa-miR-3116	PAR-CLIP	21572407
MIRT081256	hsa-miR-3148	PAR-CLIP	21572407
MIRT512182	hsa-miR-6124	PAR-CLIP	21572407
MIRT081252	hsa-miR-516a-5p	PAR-CLIP	21572407
MIRT081258	hsa-miR-3662	PAR-CLIP	23446348
MIRT081257	hsa-miR-3646	PAR-CLIP	23446348
MIRT081250	hsa-miR-148a-5p	PAR-CLIP	23446348
MIRT081259	hsa-miR-6849-3p	PAR-CLIP	23446348
MIRT524562	hsa-miR-342-3p	PAR-CLIP	23446348
MIRT081253	hsa-miR-875-3p	PAR-CLIP	23446348
MIRT081254	hsa-miR-1254	PAR-CLIP	23446348
MIRT081255	hsa-miR-3116	PAR-CLIP	23446348
MIRT081256	hsa-miR-3148	PAR-CLIP	23446348
MIRT512182	hsa-miR-6124	PAR-CLIP	23446348
MIRT081252	hsa-miR-516a-5p	PAR-CLIP	23446348
MIRT081258	hsa-miR-3662	PAR-CLIP	23446348
MIRT081257	hsa-miR-3646	PAR-CLIP	23446348
MIRT081250	hsa-miR-148a-5p	PAR-CLIP	23446348
MIRT081259	hsa-miR-6849-3p	PAR-CLIP	23446348
MIRT081253	hsa-miR-875-3p	PAR-CLIP	23446348
MIRT081254	hsa-miR-1254	PAR-CLIP	23446348
MIRT081255	hsa-miR-3116	PAR-CLIP	23446348
MIRT081256	hsa-miR-3148	PAR-CLIP	23446348
MIRT512182	hsa-miR-6124	PAR-CLIP	23446348
MIRT081252	hsa-miR-516a-5p	PAR-CLIP	23446348
MIRT480166	hsa-miR-4779	PAR-CLIP	23592263
MIRT480167	hsa-miR-3141	PAR-CLIP	23592263
MIRT480165	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT480164	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT480163	hsa-miR-6777-5p	PAR-CLIP	23592263
MIRT480162	hsa-miR-6889-5p	PAR-CLIP	23592263
MIRT480161	hsa-miR-4693-3p	PAR-CLIP	23592263
MIRT480160	hsa-miR-4706	PAR-CLIP	23592263
MIRT480159	hsa-miR-4749-5p	PAR-CLIP	23592263
MIRT480158	hsa-miR-5192	PAR-CLIP	23592263
MIRT480157	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT480156	hsa-miR-7154-3p	PAR-CLIP	23592263
MIRT480155	hsa-miR-765	PAR-CLIP	23592263
MIRT480154	hsa-miR-6894-5p	PAR-CLIP	23592263
MIRT480153	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT480152	hsa-miR-663a	PAR-CLIP	23592263
MIRT480150	hsa-miR-6787-5p	PAR-CLIP	23592263
MIRT480151	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT480149	hsa-miR-8085	PAR-CLIP	23592263
MIRT480148	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT480147	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT480146	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT480145	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT480144	hsa-miR-3175	PAR-CLIP	23592263
MIRT480143	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT480142	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT480141	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT480140	hsa-miR-5698	PAR-CLIP	23592263
MIRT480138	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT480139	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT480137	hsa-miR-4525	PAR-CLIP	23592263
MIRT480136	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT480135	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT480134	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT480133	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT480132	hsa-miR-4651	PAR-CLIP	23592263
MIRT480131	hsa-miR-608	PAR-CLIP	23592263
MIRT480130	hsa-miR-6756-5p	PAR-CLIP	23592263
MIRT480129	hsa-miR-6766-5p	PAR-CLIP	23592263
MIRT480128	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT480126	hsa-miR-7847-3p	PAR-CLIP	23592263
MIRT480127	hsa-miR-4447	PAR-CLIP	23592263
MIRT480125	hsa-miR-4472	PAR-CLIP	23592263
MIRT480124	hsa-miR-1275	PAR-CLIP	23592263
MIRT480123	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT480122	hsa-miR-4534	PAR-CLIP	23592263
MIRT480121	hsa-miR-216a-5p	PAR-CLIP	23592263
MIRT480120	hsa-miR-665	PAR-CLIP	23592263
MIRT480119	hsa-miR-4428	PAR-CLIP	23592263
MIRT480118	hsa-miR-2278	PAR-CLIP	23592263
MIRT480117	hsa-miR-4476	PAR-CLIP	23592263
MIRT480116	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT480115	hsa-miR-1245b-3p	PAR-CLIP	23592263
MIRT480114	hsa-miR-3664-3p	PAR-CLIP	23592263
MIRT480113	hsa-miR-1266-5p	PAR-CLIP	23592263
MIRT480111	hsa-miR-4518	PAR-CLIP	23592263
MIRT480112	hsa-miR-4468	PAR-CLIP	23592263
MIRT480110	hsa-miR-4533	PAR-CLIP	23592263
MIRT480109	hsa-miR-1252-3p	PAR-CLIP	23592263
MIRT480108	hsa-miR-5197-3p	PAR-CLIP	23592263
MIRT480107	hsa-miR-1321	PAR-CLIP	23592263
MIRT480106	hsa-miR-4739	PAR-CLIP	23592263
MIRT480105	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT399345	hsa-miR-6782-5p	PAR-CLIP	23592263
MIRT480104	hsa-miR-6838-3p	PAR-CLIP	23592263
MIRT480103	hsa-miR-1910-5p	PAR-CLIP	23592263
MIRT480102	hsa-miR-939-3p	PAR-CLIP	23592263
MIRT480101	hsa-miR-6852-5p	PAR-CLIP	23592263
MIRT480099	hsa-miR-6742-3p	PAR-CLIP	23592263
MIRT480100	hsa-miR-637	PAR-CLIP	23592263
MIRT480098	hsa-miR-5681a	PAR-CLIP	23592263
MIRT480097	hsa-miR-203a-3p	PAR-CLIP	23592263
MIRT480096	hsa-miR-3179	PAR-CLIP	23592263
MIRT480095	hsa-miR-1253	PAR-CLIP	23592263
MIRT480094	hsa-miR-1225-3p	PAR-CLIP	23592263
MIRT480093	hsa-miR-1914-3p	PAR-CLIP	23592263
MIRT480092	hsa-miR-5194	PAR-CLIP	23592263
MIRT480091	hsa-miR-6738-5p	PAR-CLIP	23592263
MIRT480090	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT480089	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT480088	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT480087	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT480086	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT480085	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT480084	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT480083	hsa-miR-1237-5p	PAR-CLIP	23592263
MIRT480082	hsa-miR-4488	PAR-CLIP	23592263
MIRT480081	hsa-miR-4697-5p	PAR-CLIP	23592263
MIRT480080	hsa-miR-6846-5p	PAR-CLIP	23592263
MIRT480079	hsa-miR-6848-5p	PAR-CLIP	23592263
MIRT480078	hsa-miR-1343-3p	PAR-CLIP	23592263
MIRT480077	hsa-miR-6783-3p	PAR-CLIP	23592263
MIRT441024	hsa-miR-412-3p	HITS-CLIP	24374217
MIRT441024	hsa-miR-412-3p	HITS-CLIP	24374217
MIRT723641	hsa-miR-6771-3p	HITS-CLIP	19536157
MIRT081258	hsa-miR-3662	PAR-CLIP	20371350
MIRT081257	hsa-miR-3646	PAR-CLIP	20371350
MIRT081250	hsa-miR-148a-5p	PAR-CLIP	20371350
MIRT081259	hsa-miR-6849-3p	PAR-CLIP	20371350
MIRT081253	hsa-miR-875-3p	PAR-CLIP	20371350
MIRT081254	hsa-miR-1254	PAR-CLIP	20371350
MIRT081255	hsa-miR-3116	PAR-CLIP	20371350
MIRT081256	hsa-miR-3148	PAR-CLIP	20371350
MIRT512182	hsa-miR-6124	PAR-CLIP	20371350
MIRT081252	hsa-miR-516a-5p	PAR-CLIP	20371350
MIRT081258	hsa-miR-3662	PAR-CLIP	20371350
MIRT081257	hsa-miR-3646	PAR-CLIP	20371350
MIRT081250	hsa-miR-148a-5p	PAR-CLIP	20371350
MIRT081259	hsa-miR-6849-3p	PAR-CLIP	20371350
MIRT081253	hsa-miR-875-3p	PAR-CLIP	20371350
MIRT081254	hsa-miR-1254	PAR-CLIP	20371350
MIRT081255	hsa-miR-3116	PAR-CLIP	20371350
MIRT081256	hsa-miR-3148	PAR-CLIP	20371350
MIRT512182	hsa-miR-6124	PAR-CLIP	20371350
MIRT081252	hsa-miR-516a-5p	PAR-CLIP	20371350
MIRT081258	hsa-miR-3662	PAR-CLIP	20371350
MIRT081257	hsa-miR-3646	PAR-CLIP	20371350
MIRT081250	hsa-miR-148a-5p	PAR-CLIP	20371350
MIRT081259	hsa-miR-6849-3p	PAR-CLIP	20371350
MIRT081253	hsa-miR-875-3p	PAR-CLIP	20371350
MIRT081254	hsa-miR-1254	PAR-CLIP	20371350
MIRT081255	hsa-miR-3116	PAR-CLIP	20371350
MIRT081256	hsa-miR-3148	PAR-CLIP	20371350
MIRT512182	hsa-miR-6124	PAR-CLIP	20371350
MIRT081252	hsa-miR-516a-5p	PAR-CLIP	20371350
MIRT081258	hsa-miR-3662	PAR-CLIP	20371350
MIRT081257	hsa-miR-3646	PAR-CLIP	20371350
MIRT081250	hsa-miR-148a-5p	PAR-CLIP	20371350
MIRT081259	hsa-miR-6849-3p	PAR-CLIP	20371350
MIRT081253	hsa-miR-875-3p	PAR-CLIP	20371350
MIRT081254	hsa-miR-1254	PAR-CLIP	20371350
MIRT081255	hsa-miR-3116	PAR-CLIP	20371350
MIRT081256	hsa-miR-3148	PAR-CLIP	20371350
MIRT512182	hsa-miR-6124	PAR-CLIP	20371350
MIRT081252	hsa-miR-516a-5p	PAR-CLIP	20371350
MIRT081258	hsa-miR-3662	PAR-CLIP	21572407
MIRT081257	hsa-miR-3646	PAR-CLIP	21572407
MIRT081250	hsa-miR-148a-5p	PAR-CLIP	21572407
MIRT081259	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT558968	hsa-miR-6716-3p	PAR-CLIP	21572407
MIRT081253	hsa-miR-875-3p	PAR-CLIP	21572407
MIRT081254	hsa-miR-1254	PAR-CLIP	21572407
MIRT081255	hsa-miR-3116	PAR-CLIP	21572407
MIRT081256	hsa-miR-3148	PAR-CLIP	21572407
MIRT512182	hsa-miR-6124	PAR-CLIP	21572407
MIRT081252	hsa-miR-516a-5p	PAR-CLIP	21572407
MIRT081258	hsa-miR-3662	PAR-CLIP	21572407
MIRT081257	hsa-miR-3646	PAR-CLIP	21572407
MIRT081250	hsa-miR-148a-5p	PAR-CLIP	21572407
MIRT081259	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT081253	hsa-miR-875-3p	PAR-CLIP	21572407
MIRT081254	hsa-miR-1254	PAR-CLIP	21572407
MIRT081255	hsa-miR-3116	PAR-CLIP	21572407
MIRT081256	hsa-miR-3148	PAR-CLIP	21572407
MIRT512182	hsa-miR-6124	PAR-CLIP	21572407
MIRT081252	hsa-miR-516a-5p	PAR-CLIP	21572407
MIRT081258	hsa-miR-3662	PAR-CLIP	23446348
MIRT081257	hsa-miR-3646	PAR-CLIP	23446348
MIRT081250	hsa-miR-148a-5p	PAR-CLIP	23446348
MIRT081259	hsa-miR-6849-3p	PAR-CLIP	23446348
MIRT524562	hsa-miR-342-3p	PAR-CLIP	23446348
MIRT081253	hsa-miR-875-3p	PAR-CLIP	23446348
MIRT081254	hsa-miR-1254	PAR-CLIP	23446348
MIRT081255	hsa-miR-3116	PAR-CLIP	23446348
MIRT081256	hsa-miR-3148	PAR-CLIP	23446348
MIRT512182	hsa-miR-6124	PAR-CLIP	23446348
MIRT081252	hsa-miR-516a-5p	PAR-CLIP	23446348
MIRT081258	hsa-miR-3662	PAR-CLIP	23446348
MIRT081257	hsa-miR-3646	PAR-CLIP	23446348
MIRT081250	hsa-miR-148a-5p	PAR-CLIP	23446348
MIRT081259	hsa-miR-6849-3p	PAR-CLIP	23446348
MIRT081253	hsa-miR-875-3p	PAR-CLIP	23446348
MIRT081254	hsa-miR-1254	PAR-CLIP	23446348
MIRT081255	hsa-miR-3116	PAR-CLIP	23446348
MIRT081256	hsa-miR-3148	PAR-CLIP	23446348
MIRT512182	hsa-miR-6124	PAR-CLIP	23446348
MIRT081252	hsa-miR-516a-5p	PAR-CLIP	23446348
MIRT480166	hsa-miR-4779	PAR-CLIP	23592263
MIRT480167	hsa-miR-3141	PAR-CLIP	23592263
MIRT480165	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT480164	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT480163	hsa-miR-6777-5p	PAR-CLIP	23592263
MIRT480162	hsa-miR-6889-5p	PAR-CLIP	23592263
MIRT480161	hsa-miR-4693-3p	PAR-CLIP	23592263
MIRT480160	hsa-miR-4706	PAR-CLIP	23592263
MIRT480159	hsa-miR-4749-5p	PAR-CLIP	23592263
MIRT480158	hsa-miR-5192	PAR-CLIP	23592263
MIRT480157	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT480156	hsa-miR-7154-3p	PAR-CLIP	23592263
MIRT480155	hsa-miR-765	PAR-CLIP	23592263
MIRT480154	hsa-miR-6894-5p	PAR-CLIP	23592263
MIRT480153	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT480152	hsa-miR-663a	PAR-CLIP	23592263
MIRT480150	hsa-miR-6787-5p	PAR-CLIP	23592263
MIRT480151	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT480149	hsa-miR-8085	PAR-CLIP	23592263
MIRT480148	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT480147	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT480146	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT480145	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT480144	hsa-miR-3175	PAR-CLIP	23592263
MIRT480143	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT480142	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT480141	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT480140	hsa-miR-5698	PAR-CLIP	23592263
MIRT480138	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT480139	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT480137	hsa-miR-4525	PAR-CLIP	23592263
MIRT480136	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT480135	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT480134	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT480133	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT480132	hsa-miR-4651	PAR-CLIP	23592263
MIRT480131	hsa-miR-608	PAR-CLIP	23592263
MIRT480130	hsa-miR-6756-5p	PAR-CLIP	23592263
MIRT480129	hsa-miR-6766-5p	PAR-CLIP	23592263
MIRT480128	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT480126	hsa-miR-7847-3p	PAR-CLIP	23592263
MIRT480127	hsa-miR-4447	PAR-CLIP	23592263
MIRT480125	hsa-miR-4472	PAR-CLIP	23592263
MIRT480124	hsa-miR-1275	PAR-CLIP	23592263
MIRT480123	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT480122	hsa-miR-4534	PAR-CLIP	23592263
MIRT480121	hsa-miR-216a-5p	PAR-CLIP	23592263
MIRT480120	hsa-miR-665	PAR-CLIP	23592263
MIRT480119	hsa-miR-4428	PAR-CLIP	23592263
MIRT480118	hsa-miR-2278	PAR-CLIP	23592263
MIRT480117	hsa-miR-4476	PAR-CLIP	23592263
MIRT480116	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT480115	hsa-miR-1245b-3p	PAR-CLIP	23592263
MIRT480114	hsa-miR-3664-3p	PAR-CLIP	23592263
MIRT480113	hsa-miR-1266-5p	PAR-CLIP	23592263
MIRT480111	hsa-miR-4518	PAR-CLIP	23592263
MIRT480112	hsa-miR-4468	PAR-CLIP	23592263
MIRT480110	hsa-miR-4533	PAR-CLIP	23592263
MIRT480109	hsa-miR-1252-3p	PAR-CLIP	23592263
MIRT480108	hsa-miR-5197-3p	PAR-CLIP	23592263
MIRT480107	hsa-miR-1321	PAR-CLIP	23592263
MIRT480106	hsa-miR-4739	PAR-CLIP	23592263
MIRT480105	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT399345	hsa-miR-6782-5p	PAR-CLIP	23592263
MIRT480104	hsa-miR-6838-3p	PAR-CLIP	23592263
MIRT480103	hsa-miR-1910-5p	PAR-CLIP	23592263
MIRT480102	hsa-miR-939-3p	PAR-CLIP	23592263
MIRT480101	hsa-miR-6852-5p	PAR-CLIP	23592263
MIRT480099	hsa-miR-6742-3p	PAR-CLIP	23592263
MIRT480100	hsa-miR-637	PAR-CLIP	23592263
MIRT480098	hsa-miR-5681a	PAR-CLIP	23592263
MIRT480097	hsa-miR-203a-3p	PAR-CLIP	23592263
MIRT480096	hsa-miR-3179	PAR-CLIP	23592263
MIRT480095	hsa-miR-1253	PAR-CLIP	23592263
MIRT480094	hsa-miR-1225-3p	PAR-CLIP	23592263
MIRT480093	hsa-miR-1914-3p	PAR-CLIP	23592263
MIRT480092	hsa-miR-5194	PAR-CLIP	23592263
MIRT480091	hsa-miR-6738-5p	PAR-CLIP	23592263
MIRT480090	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT480089	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT480088	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT480087	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT480086	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT480085	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT480084	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT480083	hsa-miR-1237-5p	PAR-CLIP	23592263
MIRT480082	hsa-miR-4488	PAR-CLIP	23592263
MIRT480081	hsa-miR-4697-5p	PAR-CLIP	23592263
MIRT480080	hsa-miR-6846-5p	PAR-CLIP	23592263
MIRT480079	hsa-miR-6848-5p	PAR-CLIP	23592263
MIRT480078	hsa-miR-1343-3p	PAR-CLIP	23592263
MIRT480077	hsa-miR-6783-3p	PAR-CLIP	23592263
MIRT859732	hsa-miR-1252	CLIP-seq
MIRT859733	hsa-miR-1343	CLIP-seq
MIRT859734	hsa-miR-146a	CLIP-seq
MIRT859735	hsa-miR-146b-5p	CLIP-seq
MIRT859736	hsa-miR-181a	CLIP-seq
MIRT859737	hsa-miR-181b	CLIP-seq
MIRT859738	hsa-miR-181c	CLIP-seq
MIRT859739	hsa-miR-181d	CLIP-seq
MIRT859740	hsa-miR-1909	CLIP-seq
MIRT859741	hsa-miR-1910	CLIP-seq
MIRT859742	hsa-miR-1912	CLIP-seq
MIRT859743	hsa-miR-1913	CLIP-seq
MIRT859744	hsa-miR-2116	CLIP-seq
MIRT859745	hsa-miR-3136-3p	CLIP-seq
MIRT859746	hsa-miR-3163	CLIP-seq
MIRT859747	hsa-miR-3168	CLIP-seq
MIRT859748	hsa-miR-3189-5p	CLIP-seq
MIRT859749	hsa-miR-3192	CLIP-seq
MIRT859750	hsa-miR-324-3p	CLIP-seq
MIRT859751	hsa-miR-3616-3p	CLIP-seq
MIRT859752	hsa-miR-3649	CLIP-seq
MIRT859753	hsa-miR-3674	CLIP-seq
MIRT859754	hsa-miR-3677-5p	CLIP-seq
MIRT859755	hsa-miR-4262	CLIP-seq
MIRT859756	hsa-miR-4264	CLIP-seq
MIRT859757	hsa-miR-4302	CLIP-seq
MIRT859758	hsa-miR-4314	CLIP-seq
MIRT859759	hsa-miR-4446-3p	CLIP-seq
MIRT859760	hsa-miR-4646-5p	CLIP-seq
MIRT859761	hsa-miR-4656	CLIP-seq
MIRT859762	hsa-miR-4668-3p	CLIP-seq
MIRT859763	hsa-miR-4703-3p	CLIP-seq
MIRT859764	hsa-miR-4710	CLIP-seq
MIRT859765	hsa-miR-4721	CLIP-seq
MIRT859766	hsa-miR-4758-3p	CLIP-seq
MIRT859767	hsa-miR-4795-5p	CLIP-seq
MIRT859768	hsa-miR-4797-3p	CLIP-seq
MIRT859769	hsa-miR-548aa	CLIP-seq
MIRT859770	hsa-miR-577	CLIP-seq
MIRT859771	hsa-miR-589	CLIP-seq
MIRT859772	hsa-miR-600	CLIP-seq
MIRT859773	hsa-miR-663b	CLIP-seq
MIRT859732	hsa-miR-1252	CLIP-seq
MIRT859734	hsa-miR-146a	CLIP-seq
MIRT859735	hsa-miR-146b-5p	CLIP-seq
MIRT859751	hsa-miR-3616-3p	CLIP-seq
MIRT859759	hsa-miR-4446-3p	CLIP-seq
MIRT859761	hsa-miR-4656	CLIP-seq
MIRT859764	hsa-miR-4710	CLIP-seq
MIRT859765	hsa-miR-4721	CLIP-seq
MIRT859771	hsa-miR-589	CLIP-seq
MIRT1556114	hsa-miR-143	CLIP-seq
MIRT859734	hsa-miR-146a	CLIP-seq
MIRT859735	hsa-miR-146b-5p	CLIP-seq
MIRT859741	hsa-miR-1910	CLIP-seq
MIRT1556115	hsa-miR-31	CLIP-seq
MIRT1556116	hsa-miR-3154	CLIP-seq
MIRT1556117	hsa-miR-4712-3p	CLIP-seq
MIRT1556118	hsa-miR-4770	CLIP-seq
MIRT859771	hsa-miR-589	CLIP-seq
MIRT1556114	hsa-miR-143	CLIP-seq
MIRT1556115	hsa-miR-31	CLIP-seq
MIRT1556116	hsa-miR-3154	CLIP-seq
MIRT1920028	hsa-miR-361-3p	CLIP-seq
MIRT1920029	hsa-miR-4300	CLIP-seq
MIRT1920030	hsa-miR-4313	CLIP-seq
MIRT1920031	hsa-miR-4443	CLIP-seq
MIRT1920032	hsa-miR-4633-3p	CLIP-seq
MIRT1556117	hsa-miR-4712-3p	CLIP-seq
MIRT1920033	hsa-miR-4726-3p	CLIP-seq
MIRT1556118	hsa-miR-4770	CLIP-seq
MIRT1920034	hsa-miR-610	CLIP-seq
MIRT1920035	hsa-miR-920	CLIP-seq
MIRT1920036	hsa-miR-939	CLIP-seq
MIRT1556114	hsa-miR-143	CLIP-seq
MIRT859734	hsa-miR-146a	CLIP-seq
MIRT859735	hsa-miR-146b-5p	CLIP-seq
MIRT1556115	hsa-miR-31	CLIP-seq
MIRT1556116	hsa-miR-3154	CLIP-seq
MIRT1920028	hsa-miR-361-3p	CLIP-seq
MIRT1920029	hsa-miR-4300	CLIP-seq
MIRT1920030	hsa-miR-4313	CLIP-seq
MIRT1920031	hsa-miR-4443	CLIP-seq
MIRT1920032	hsa-miR-4633-3p	CLIP-seq
MIRT1556117	hsa-miR-4712-3p	CLIP-seq
MIRT1920033	hsa-miR-4726-3p	CLIP-seq
MIRT1556118	hsa-miR-4770	CLIP-seq
MIRT859771	hsa-miR-589	CLIP-seq
MIRT1920034	hsa-miR-610	CLIP-seq
MIRT1920035	hsa-miR-920	CLIP-seq
MIRT1920036	hsa-miR-939	CLIP-seq
MIRT1556114	hsa-miR-143	CLIP-seq
MIRT1556115	hsa-miR-31	CLIP-seq
MIRT1556116	hsa-miR-3154	CLIP-seq
MIRT1920028	hsa-miR-361-3p	CLIP-seq
MIRT1920029	hsa-miR-4300	CLIP-seq
MIRT1920030	hsa-miR-4313	CLIP-seq
MIRT1920031	hsa-miR-4443	CLIP-seq
MIRT1920032	hsa-miR-4633-3p	CLIP-seq
MIRT1556117	hsa-miR-4712-3p	CLIP-seq
MIRT1920033	hsa-miR-4726-3p	CLIP-seq
MIRT1556118	hsa-miR-4770	CLIP-seq
MIRT1920034	hsa-miR-610	CLIP-seq
MIRT1920035	hsa-miR-920	CLIP-seq
MIRT1920036	hsa-miR-939	CLIP-seq
MIRT1556114	hsa-miR-143	CLIP-seq
MIRT1556115	hsa-miR-31	CLIP-seq
MIRT1556116	hsa-miR-3154	CLIP-seq
MIRT1920028	hsa-miR-361-3p	CLIP-seq
MIRT1920029	hsa-miR-4300	CLIP-seq
MIRT1920030	hsa-miR-4313	CLIP-seq
MIRT1920031	hsa-miR-4443	CLIP-seq
MIRT1920032	hsa-miR-4633-3p	CLIP-seq
MIRT1556117	hsa-miR-4712-3p	CLIP-seq
MIRT1920033	hsa-miR-4726-3p	CLIP-seq
MIRT1556118	hsa-miR-4770	CLIP-seq
MIRT1920034	hsa-miR-610	CLIP-seq
MIRT1920035	hsa-miR-920	CLIP-seq
MIRT1920036	hsa-miR-939	CLIP-seq
MIRT859734	hsa-miR-146a	CLIP-seq
MIRT859735	hsa-miR-146b-5p	CLIP-seq
MIRT859741	hsa-miR-1910	CLIP-seq
MIRT1955212	hsa-miR-1972	CLIP-seq
MIRT1955213	hsa-miR-203	CLIP-seq
MIRT1556115	hsa-miR-31	CLIP-seq
MIRT1955214	hsa-miR-3194-3p	CLIP-seq
MIRT859756	hsa-miR-4264	CLIP-seq
MIRT1955215	hsa-miR-4267	CLIP-seq
MIRT1955216	hsa-miR-4650-5p	CLIP-seq
MIRT1955217	hsa-miR-4722-5p	CLIP-seq
MIRT1955218	hsa-miR-4734	CLIP-seq
MIRT859771	hsa-miR-589	CLIP-seq
MIRT1955219	hsa-miR-625	CLIP-seq
MIRT2192878	hsa-miR-1270	CLIP-seq
MIRT2192879	hsa-miR-148a	CLIP-seq
MIRT2192880	hsa-miR-148b	CLIP-seq
MIRT2192881	hsa-miR-152	CLIP-seq
MIRT859740	hsa-miR-1909	CLIP-seq
MIRT859742	hsa-miR-1912	CLIP-seq
MIRT859743	hsa-miR-1913	CLIP-seq
MIRT1955213	hsa-miR-203	CLIP-seq
MIRT859748	hsa-miR-3189-5p	CLIP-seq
MIRT859749	hsa-miR-3192	CLIP-seq
MIRT859750	hsa-miR-324-3p	CLIP-seq
MIRT1920028	hsa-miR-361-3p	CLIP-seq
MIRT859752	hsa-miR-3649	CLIP-seq
MIRT859754	hsa-miR-3677-5p	CLIP-seq
MIRT859756	hsa-miR-4264	CLIP-seq
MIRT859757	hsa-miR-4302	CLIP-seq
MIRT859758	hsa-miR-4314	CLIP-seq
MIRT2192882	hsa-miR-4531	CLIP-seq
MIRT859760	hsa-miR-4646-5p	CLIP-seq
MIRT1920033	hsa-miR-4726-3p	CLIP-seq
MIRT2192883	hsa-miR-4731-5p	CLIP-seq
MIRT859766	hsa-miR-4758-3p	CLIP-seq
MIRT859767	hsa-miR-4795-5p	CLIP-seq
MIRT859768	hsa-miR-4797-3p	CLIP-seq
MIRT2192884	hsa-miR-512-3p	CLIP-seq
MIRT2192885	hsa-miR-620	CLIP-seq
MIRT2192886	hsa-miR-711	CLIP-seq
MIRT859740	hsa-miR-1909	CLIP-seq
MIRT2495980	hsa-miR-1237	CLIP-seq
MIRT859732	hsa-miR-1252	CLIP-seq
MIRT2495981	hsa-miR-1266	CLIP-seq
MIRT2192878	hsa-miR-1270	CLIP-seq
MIRT2495982	hsa-miR-1285	CLIP-seq
MIRT859733	hsa-miR-1343	CLIP-seq
MIRT1556114	hsa-miR-143	CLIP-seq
MIRT859734	hsa-miR-146a	CLIP-seq
MIRT859735	hsa-miR-146b-5p	CLIP-seq
MIRT2192879	hsa-miR-148a	CLIP-seq
MIRT2192880	hsa-miR-148b	CLIP-seq
MIRT2192881	hsa-miR-152	CLIP-seq
MIRT859736	hsa-miR-181a	CLIP-seq
MIRT859737	hsa-miR-181b	CLIP-seq
MIRT859738	hsa-miR-181c	CLIP-seq
MIRT859739	hsa-miR-181d	CLIP-seq
MIRT859740	hsa-miR-1909	CLIP-seq
MIRT859741	hsa-miR-1910	CLIP-seq
MIRT859742	hsa-miR-1912	CLIP-seq
MIRT859743	hsa-miR-1913	CLIP-seq
MIRT1955212	hsa-miR-1972	CLIP-seq
MIRT1955213	hsa-miR-203	CLIP-seq
MIRT859744	hsa-miR-2116	CLIP-seq
MIRT2495983	hsa-miR-216a	CLIP-seq
MIRT1556115	hsa-miR-31	CLIP-seq
MIRT2495984	hsa-miR-3127-3p	CLIP-seq
MIRT859745	hsa-miR-3136-3p	CLIP-seq
MIRT1556116	hsa-miR-3154	CLIP-seq
MIRT859746	hsa-miR-3163	CLIP-seq
MIRT859747	hsa-miR-3168	CLIP-seq
MIRT2495985	hsa-miR-3187-5p	CLIP-seq
MIRT859748	hsa-miR-3189-5p	CLIP-seq
MIRT859749	hsa-miR-3192	CLIP-seq
MIRT859750	hsa-miR-324-3p	CLIP-seq
MIRT2495986	hsa-miR-326	CLIP-seq
MIRT2495987	hsa-miR-330-5p	CLIP-seq
MIRT1920028	hsa-miR-361-3p	CLIP-seq
MIRT859751	hsa-miR-3616-3p	CLIP-seq
MIRT859752	hsa-miR-3649	CLIP-seq
MIRT859753	hsa-miR-3674	CLIP-seq
MIRT859754	hsa-miR-3677-5p	CLIP-seq
MIRT2495988	hsa-miR-378g	CLIP-seq
MIRT859755	hsa-miR-4262	CLIP-seq
MIRT859756	hsa-miR-4264	CLIP-seq
MIRT2495989	hsa-miR-4282	CLIP-seq
MIRT2495990	hsa-miR-4290	CLIP-seq
MIRT1920029	hsa-miR-4300	CLIP-seq
MIRT859757	hsa-miR-4302	CLIP-seq
MIRT1920030	hsa-miR-4313	CLIP-seq
MIRT859758	hsa-miR-4314	CLIP-seq
MIRT2495991	hsa-miR-4437	CLIP-seq
MIRT1920031	hsa-miR-4443	CLIP-seq
MIRT859759	hsa-miR-4446-3p	CLIP-seq
MIRT2495992	hsa-miR-4474-3p	CLIP-seq
MIRT2495993	hsa-miR-4486	CLIP-seq
MIRT2192882	hsa-miR-4531	CLIP-seq
MIRT1920032	hsa-miR-4633-3p	CLIP-seq
MIRT2495994	hsa-miR-4640-3p	CLIP-seq
MIRT859760	hsa-miR-4646-5p	CLIP-seq
MIRT1955216	hsa-miR-4650-5p	CLIP-seq
MIRT859761	hsa-miR-4656	CLIP-seq
MIRT2495995	hsa-miR-4667-3p	CLIP-seq
MIRT2495996	hsa-miR-4674	CLIP-seq
MIRT859763	hsa-miR-4703-3p	CLIP-seq
MIRT859764	hsa-miR-4710	CLIP-seq
MIRT1556117	hsa-miR-4712-3p	CLIP-seq
MIRT859765	hsa-miR-4721	CLIP-seq
MIRT1920033	hsa-miR-4726-3p	CLIP-seq
MIRT2192883	hsa-miR-4731-5p	CLIP-seq
MIRT859766	hsa-miR-4758-3p	CLIP-seq
MIRT1556118	hsa-miR-4770	CLIP-seq
MIRT2495997	hsa-miR-4775	CLIP-seq
MIRT859767	hsa-miR-4795-5p	CLIP-seq
MIRT859768	hsa-miR-4797-3p	CLIP-seq
MIRT2192884	hsa-miR-512-3p	CLIP-seq
MIRT2495998	hsa-miR-515-5p	CLIP-seq
MIRT859770	hsa-miR-577	CLIP-seq
MIRT859771	hsa-miR-589	CLIP-seq
MIRT859772	hsa-miR-600	CLIP-seq
MIRT1920034	hsa-miR-610	CLIP-seq
MIRT2495999	hsa-miR-612	CLIP-seq
MIRT2192885	hsa-miR-620	CLIP-seq
MIRT2496000	hsa-miR-633	CLIP-seq
MIRT859773	hsa-miR-663b	CLIP-seq
MIRT2192886	hsa-miR-711	CLIP-seq
MIRT1920035	hsa-miR-920	CLIP-seq
MIRT1920036	hsa-miR-939	CLIP-seq
MIRT2495980	hsa-miR-1237	CLIP-seq
MIRT859732	hsa-miR-1252	CLIP-seq
MIRT2495981	hsa-miR-1266	CLIP-seq
MIRT2192878	hsa-miR-1270	CLIP-seq
MIRT2495982	hsa-miR-1285	CLIP-seq
MIRT859733	hsa-miR-1343	CLIP-seq
MIRT1556114	hsa-miR-143	CLIP-seq
MIRT859734	hsa-miR-146a	CLIP-seq
MIRT859735	hsa-miR-146b-5p	CLIP-seq
MIRT2192879	hsa-miR-148a	CLIP-seq
MIRT2192880	hsa-miR-148b	CLIP-seq
MIRT2192881	hsa-miR-152	CLIP-seq
MIRT859736	hsa-miR-181a	CLIP-seq
MIRT859737	hsa-miR-181b	CLIP-seq
MIRT859738	hsa-miR-181c	CLIP-seq
MIRT859739	hsa-miR-181d	CLIP-seq
MIRT859740	hsa-miR-1909	CLIP-seq
MIRT859741	hsa-miR-1910	CLIP-seq
MIRT859742	hsa-miR-1912	CLIP-seq
MIRT859743	hsa-miR-1913	CLIP-seq
MIRT1955212	hsa-miR-1972	CLIP-seq
MIRT1955213	hsa-miR-203	CLIP-seq
MIRT859744	hsa-miR-2116	CLIP-seq
MIRT2495983	hsa-miR-216a	CLIP-seq
MIRT1556115	hsa-miR-31	CLIP-seq
MIRT2495984	hsa-miR-3127-3p	CLIP-seq
MIRT859745	hsa-miR-3136-3p	CLIP-seq
MIRT1556116	hsa-miR-3154	CLIP-seq
MIRT859746	hsa-miR-3163	CLIP-seq
MIRT859747	hsa-miR-3168	CLIP-seq
MIRT2495985	hsa-miR-3187-5p	CLIP-seq
MIRT859748	hsa-miR-3189-5p	CLIP-seq
MIRT859749	hsa-miR-3192	CLIP-seq
MIRT1955214	hsa-miR-3194-3p	CLIP-seq
MIRT859750	hsa-miR-324-3p	CLIP-seq
MIRT2495986	hsa-miR-326	CLIP-seq
MIRT2495987	hsa-miR-330-5p	CLIP-seq
MIRT1920028	hsa-miR-361-3p	CLIP-seq
MIRT859751	hsa-miR-3616-3p	CLIP-seq
MIRT859752	hsa-miR-3649	CLIP-seq
MIRT859753	hsa-miR-3674	CLIP-seq
MIRT859754	hsa-miR-3677-5p	CLIP-seq
MIRT2495988	hsa-miR-378g	CLIP-seq
MIRT859755	hsa-miR-4262	CLIP-seq
MIRT859756	hsa-miR-4264	CLIP-seq
MIRT1955215	hsa-miR-4267	CLIP-seq
MIRT2495989	hsa-miR-4282	CLIP-seq
MIRT2495990	hsa-miR-4290	CLIP-seq
MIRT1920029	hsa-miR-4300	CLIP-seq
MIRT859757	hsa-miR-4302	CLIP-seq
MIRT1920030	hsa-miR-4313	CLIP-seq
MIRT859758	hsa-miR-4314	CLIP-seq
MIRT2495991	hsa-miR-4437	CLIP-seq
MIRT1920031	hsa-miR-4443	CLIP-seq
MIRT859759	hsa-miR-4446-3p	CLIP-seq
MIRT2495992	hsa-miR-4474-3p	CLIP-seq
MIRT2677249	hsa-miR-4479	CLIP-seq
MIRT2495993	hsa-miR-4486	CLIP-seq
MIRT2192882	hsa-miR-4531	CLIP-seq
MIRT1920032	hsa-miR-4633-3p	CLIP-seq
MIRT2677250	hsa-miR-4634	CLIP-seq
MIRT2495994	hsa-miR-4640-3p	CLIP-seq
MIRT859760	hsa-miR-4646-5p	CLIP-seq
MIRT1955216	hsa-miR-4650-5p	CLIP-seq
MIRT859761	hsa-miR-4656	CLIP-seq
MIRT2495995	hsa-miR-4667-3p	CLIP-seq
MIRT2495996	hsa-miR-4674	CLIP-seq
MIRT859763	hsa-miR-4703-3p	CLIP-seq
MIRT859764	hsa-miR-4710	CLIP-seq
MIRT1556117	hsa-miR-4712-3p	CLIP-seq
MIRT859765	hsa-miR-4721	CLIP-seq
MIRT1920033	hsa-miR-4726-3p	CLIP-seq
MIRT2192883	hsa-miR-4731-5p	CLIP-seq
MIRT1955218	hsa-miR-4734	CLIP-seq
MIRT859766	hsa-miR-4758-3p	CLIP-seq
MIRT1556118	hsa-miR-4770	CLIP-seq
MIRT2495997	hsa-miR-4775	CLIP-seq
MIRT859767	hsa-miR-4795-5p	CLIP-seq
MIRT859768	hsa-miR-4797-3p	CLIP-seq
MIRT2192884	hsa-miR-512-3p	CLIP-seq
MIRT2495998	hsa-miR-515-5p	CLIP-seq
MIRT859770	hsa-miR-577	CLIP-seq
MIRT859771	hsa-miR-589	CLIP-seq
MIRT859772	hsa-miR-600	CLIP-seq
MIRT1920034	hsa-miR-610	CLIP-seq
MIRT2495999	hsa-miR-612	CLIP-seq
MIRT2192885	hsa-miR-620	CLIP-seq
MIRT2496000	hsa-miR-633	CLIP-seq
MIRT859773	hsa-miR-663b	CLIP-seq
MIRT2192886	hsa-miR-711	CLIP-seq
MIRT1920035	hsa-miR-920	CLIP-seq
MIRT1920036	hsa-miR-939	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	8107809
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0001849	Function	Complement component C1q complex binding	IPI	9922153
GO:0001849	Function	Complement component C1q complex binding	TAS	15474971
GO:0002502	Process	Peptide antigen assembly with MHC class I protein complex	IDA	36104323
GO:0002502	Process	Peptide antigen assembly with MHC class I protein complex	IDA	35948544
GO:0002502	Process	Peptide antigen assembly with MHC class I protein complex	IEA
GO:0002502	Process	Peptide antigen assembly with MHC class I protein complex	ISS	11825569
GO:0003677	Function	DNA binding	NAS	11149926
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003729	Function	MRNA binding	IDA	14726956
GO:0003729	Function	MRNA binding	IEA
GO:0005049	Function	Nuclear export signal receptor activity	IDA	11149926
GO:0005178	Function	Integrin binding	IPI	1911778
GO:0005506	Function	Iron ion binding	IEA
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IDA	21590275
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	IMP	21705382
GO:0005509	Function	Calcium ion binding	ISS
GO:0005509	Function	Calcium ion binding	TAS	7841019, 11149926
GO:0005515	Function	Protein binding	IPI	9640257, 10605026, 15056662, 15896298, 17055437, 17215244, 17916189, 18177377, 19154346, 20562859, 21900206, 25241761, 25277244, 26514267, 28298427, 30108113, 32296183, 32814053, 36417879
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	IMP	22377355
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IDA	8107809
GO:0005635	Component	Nuclear envelope	IDA	21590275
GO:0005635	Component	Nuclear envelope	IEA
GO:0005737	Component	Cytoplasm	IDA	1911778
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005764	Component	Lysosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	23011799, 23395171, 30188326
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	TAS	16130169
GO:0005788	Component	Endoplasmic reticulum lumen	IDA	11149926, 21590275
GO:0005788	Component	Endoplasmic reticulum lumen	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005790	Component	Smooth endoplasmic reticulum	IEA
GO:0005829	Component	Cytosol	IDA	11149926
GO:0005829	Component	Cytosol	IEA
GO:0005840	Component	Ribosome	IDA	14726956
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006355	Process	Regulation of DNA-templated transcription	TAS	8107808
GO:0006457	Process	Protein folding	IBA
GO:0006457	Process	Protein folding	IDA	17563366
GO:0006457	Process	Protein folding	IEA
GO:0006457	Process	Protein folding	TAS	15474971
GO:0006611	Process	Protein export from nucleus	IDA	11149926
GO:0006874	Process	Intracellular calcium ion homeostasis	TAS	11149926
GO:0007283	Process	Spermatogenesis	IEA
GO:0008270	Function	Zinc ion binding	TAS	15474971
GO:0008284	Process	Positive regulation of cell population proliferation	IGI	14726956
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IEA
GO:0009986	Component	Cell surface	TAS	15474971
GO:0010595	Process	Positive regulation of endothelial cell migration	IMP	22377355
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0012505	Component	Endomembrane system	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IDA	22572157
GO:0016529	Component	Sarcoplasmic reticulum	IEA
GO:0017148	Process	Negative regulation of translation	IDA	14726956
GO:0017148	Process	Negative regulation of translation	TAS	12242300
GO:0030246	Function	Carbohydrate binding	IEA
GO:0030246	Function	Carbohydrate binding	TAS	15474971
GO:0030670	Component	Phagocytic vesicle membrane	TAS
GO:0030866	Process	Cortical actin cytoskeleton organization	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	8666824
GO:0032355	Process	Response to estradiol	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0033018	Component	Sarcoplasmic reticulum lumen	IEA
GO:0033116	Component	Endoplasmic reticulum-Golgi intermediate compartment membrane	TAS
GO:0033144	Process	Negative regulation of intracellular steroid hormone receptor signaling pathway	IDA	8107809
GO:0033574	Process	Response to testosterone	IEA
GO:0034504	Process	Protein localization to nucleus	IDA	15998798
GO:0034504	Process	Protein localization to nucleus	IEA
GO:0034975	Process	Protein folding in endoplasmic reticulum	TAS	22013210
GO:0036503	Process	ERAD pathway	IBA
GO:0040020	Process	Regulation of meiotic nuclear division	IEA
GO:0042277	Function	Peptide binding	IEA
GO:0042562	Function	Hormone binding	IEA
GO:0042824	Component	MHC class I peptide loading complex	IDA	21263072, 35948544
GO:0042824	Component	MHC class I peptide loading complex	IEA
GO:0042824	Component	MHC class I peptide loading complex	ISS	11825569
GO:0042921	Process	Nuclear receptor-mediated glucocorticoid signaling pathway	TAS	8107809
GO:0042981	Process	Regulation of apoptotic process	TAS	16130169
GO:0044183	Function	Protein folding chaperone	IDA	17563366
GO:0044183	Function	Protein folding chaperone	TAS	15474971
GO:0044194	Component	Cytolytic granule	IEA
GO:0044322	Component	Endoplasmic reticulum quality control compartment	IEA
GO:0045665	Process	Negative regulation of neuron differentiation	IDA	8107809
GO:0045787	Process	Positive regulation of cell cycle	IEA
GO:0045787	Process	Positive regulation of cell cycle	IGI	14726956
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	8107809
GO:0046872	Function	Metal ion binding	IEA
GO:0048387	Process	Negative regulation of retinoic acid receptor signaling pathway	IDA	8107809
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	1911778
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050681	Function	Nuclear androgen receptor binding	IDA	8107809
GO:0050766	Process	Positive regulation of phagocytosis	IEA
GO:0050766	Process	Positive regulation of phagocytosis	ISS
GO:0050821	Process	Protein stabilization	IDA	17563366
GO:0050821	Process	Protein stabilization	IEA
GO:0050821	Process	Protein stabilization	ISS
GO:0050821	Process	Protein stabilization	TAS	10581245
GO:0051082	Function	Unfolded protein binding	IEA
GO:0051082	Function	Unfolded protein binding	TAS	15474971
GO:0051087	Function	Protein-folding chaperone binding	TAS	15474971
GO:0051208	Process	Sequestering of calcium ion	TAS	15474971
GO:0051604	Process	Protein maturation	IDA	17563366
GO:0055007	Process	Cardiac muscle cell differentiation	IEA
GO:0060473	Component	Cortical granule	IEA
GO:0060473	Component	Cortical granule	ISS
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0071257	Process	Cellular response to electrical stimulus	IEA
GO:0071285	Process	Cellular response to lithium ion	IEA
GO:0071682	Component	Endocytic vesicle lumen	TAS
GO:0090398	Process	Cellular senescence	IEA
GO:0090398	Process	Cellular senescence	IGI	14726956
GO:0098553	Component	Lumenal side of endoplasmic reticulum membrane	TAS
GO:0098586	Process	Cellular response to virus	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0140313	Function	Molecular sequestering activity	IDA	35948544
GO:1900026	Process	Positive regulation of substrate adhesion-dependent cell spreading	IMP	11859136
GO:1901164	Process	Negative regulation of trophoblast cell migration	IMP	22377355
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IEA
GO:1901652	Process	Response to peptide	IEA
GO:1903416	Process	Response to glycoside	IEA
GO:1904614	Process	Response to biphenyl	IEA
GO:2000510	Process	Positive regulation of dendritic cell chemotaxis	IMP	16140380

Other IDs

• MIM: 109091
• HGNC: 1455
• e!Ensembl: ENSG00000179218

Protein

• UniProt ID: P27797
• Protein name: Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60)
• Protein function: Calcium-binding chaperone that promotes folding, oligomeric assembly and quality control in the endoplasmic reticulum (ER) via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoprotei
• PDB: 2CLR, 3DOW, 3POS, 3POW, 5LK5, 5V90, 6ENY, 7QPD, 8TZO, 8TZR
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00262	Calreticulin	23 → 259	Calreticulin family	Family
  PF00262	Calreticulin	257 → 332	Calreticulin family	Family

• Sequence:

  MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDE
  EKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQT
  DMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDN
  TYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPE
  HIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYS
  PDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDK
  QDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL

• Sequence length: 417

Pathways

KEGG:

Protein processing in endoplasmic reticulum
Phagosome
Efferocytosis
Antigen processing and presentation
Chagas disease
Human cytomegalovirus infection
Human T-cell leukemia virus 1 infection
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Human immunodeficiency virus 1 infection

Reactome:

ER-Phagosome pathway
Assembly of Viral Components at the Budding Site
Scavenging by Class A Receptors
Scavenging by Class F Receptors
ATF6 (ATF6-alpha) activates chaperone genes
Calnexin/calreticulin cycle
Antigen Presentation: Folding, assembly and peptide loading of class I MHC

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Acute myeloid leukemia	Likely pathogenic; Pathogenic	rs1555760738	RCV003883130	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Essential thrombocythemia	Likely pathogenic; Pathogenic	rs1555760738	RCV003883131	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Primary myelofibrosis	Pathogenic; Likely pathogenic	rs765476509, rs1555760738	RCV004796606 RCV000083256	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Thrombocythemia 1	Pathogenic; Likely pathogenic	rs765476509, rs1555760738	RCV001329863 RCV000083257	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BUDD-CHIARI SYNDROME	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CALR-related disorder	Benign; Likely benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL SQUAMOUS CELL CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYELOPROLIFERATIVE DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONORGANIC PSYCHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARANOID SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOAFFECTIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SIDEROBLASTIC ANEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOCYTHEMIA, ESSENTIAL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOCYTOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acromegaly	Acromegaly	BEFREE	29853879, 31055976		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	31741139		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	31837008		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	15855281, 22915645, 27802968, 31340059		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	15289361, 27429017		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	17390051		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	26221725, 31171903		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	26452990		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	27465041		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of rectum	Adenocarcinoma Of Rectum	BEFREE	27672742		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	17122504, 22490521, 22510757, 23648458, 24925057, 27125587, 28444509, 28723863, 30116263		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	29564561, 31729028		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	19626481, 29564561, 29956755		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	24533081		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	23587357	Stimulate	★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	30246353, 30708133		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	29750173		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	29115893		★☆☆☆☆ Found in Text Mining only
Alagille Syndrome	Alagille syndrome	Pubtator	22487239	Associate	★☆☆☆☆ Found in Text Mining only
AMYLOIDOSIS, HEREDITARY, TRANSTHYRETIN-RELATED	Amyloidosis	BEFREE	19626481		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	30518112		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	22429966		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	24986690, 26119186, 29858023, 30864463, 31107982		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	24986690	Inhibit	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	31107982, 36183610	Associate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	32323496	Stimulate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29274781		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	BEFREE	30777133		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28189968		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	29670135		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	24988887, 35027076	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	9630166, 9862695		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28189968		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	23465222, 31811440		★☆☆☆☆ Found in Text Mining only
Atrioventricular Block	Atrioventricular block	BEFREE	19330707, 30761919		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	19108895, 27354406, 28565882, 29495436		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	20834237, 21209908	Associate	★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	39237030	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	31414226		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	18771604		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	LHGDN	15596044		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	24593306, 29989024		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	25873496		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	28228150		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21133637, 22393307, 27788031, 28454292, 29042925, 29138861, 29151967, 29306221, 29434859, 30404664, 30592274, 30723582, 31365118, 31788104		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20005186, 20534901, 20834237, 21133637, 21206008, 22355776, 22393307, 23334957, 29138861, 30592274, 34706936, 34910788, 37762557	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	BEFREE	28652209, 30669362		★☆☆☆☆ Found in Text Mining only
Budd-Chiari Syndrome	Budd-Chiari syndrome	BEFREE	29803161		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bulimia	Bulimia	BEFREE	29278718		★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	32923154	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	17131471, 23587357	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	24060004, 28614199, 31747968		★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	20534901, 21197096	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	20834237, 23334957	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19861515, 35724265	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26307067	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	24593306, 29989024		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28302866, 28916844		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	27561105	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	28630212, 36646952, 36932108	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	23024775	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	35264066	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22773372, 28245631, 28260038, 31509615		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	10951187, 28251724, 28846805, 29697764, 29915621, 31147194		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	33835720	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	33835720	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	23818963		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	23818963, 28843719		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30103017, 30584028, 31109689		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	38067122	Associate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	30067866		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30471633, 31731111		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	14985791, 17146630, 23715898, 30217165		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	23024775		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	17146630, 23715898, 30217165		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	30382603		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	22415851		★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	27886920		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	27629147		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21209908, 26402369		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	24371211, 24553179, 24849893, 24957246, 25023898, 25068507, 25115511, 25116092, 25139710, 25173966, 25349114, 25482455, 25553276, 25696868, 25860380, 25873496, 25976465, 26071474, 26227853, 26280900, 26290261, 26370832, 26375990, 26402369, 26460248, 26486739, 26501981, 26538820, 26555437, 26596525, 26754830, 26817954, 26951227, 27013444, 27018326, 27061303, 27114372, 27124925, 27177927, 27258562, 27384487, 27423004, 27427771, 27444979, 27486987, 27544663, 27686170, 27686171, 27693531, 27716741, 27740635, 27764253, 27939919, 28060252, 28161773, 28168700, 28228104, 28314843, 28340692, 28389907, 28406068, 28411309, 28470469, 28483676, 28559287, 28589084, 28625126, 28741795, 28990497, 29027642, 29042365, 29047144, 29217833, 29256926, 29258411, 29364275, 29464483, 29492207, 29617043, 29641446, 29741776, 29776538, 29946189, 29946821, 29951914, 30001747, 30039550, 30084272, 30292681, 30429377, 30470838, 30655313, 30655510, 31248375, 31266769, 31332222, 31369569, 31377025, 31462733, 31562135, 31810292, 31848992		★☆☆☆☆ Found in Text Mining only
Chronic Neutrophilic Leukemia	Neutrophilic Leukemia	BEFREE	25316523		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30774324		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	16762624		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	29036211, 29773794		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	35185383	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19881547, 27026680, 31789933		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	12704787		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	17187072		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22490521, 26510091, 26913609, 27125587, 27376251, 27705923, 29516270, 30738693, 31003768, 31584324		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	17187072		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20480531, 24762493, 26913599, 36131027, 36228414	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Complement deficiency disease	Complement Component Deficiency	BEFREE	3265961		★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	11257091, 16546685, 20499382, 25994441, 28626076, 28843719, 29466958, 9667364		★☆☆☆☆ Found in Text Mining only
Congenital amegakaryocytic thrombocytopenia	Congenital amegakaryocytic thrombocytopenia	Pubtator	34010413	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	26130950		★☆☆☆☆ Found in Text Mining only
Congenital myasthenic syndrome with episodic apnea	Congenital myasthenic syndrome	Pubtator	38404143	Associate	★☆☆☆☆ Found in Text Mining only
Congenital secretory diarrhea, sodium type (disorder)	Congenital secretory diarrhea	BEFREE	29175096		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	23736534, 27338764, 27862715, 27886920, 28003221, 28383431, 28427578, 28653309, 28688704, 28846805, 29086228, 29151496, 29525386, 29625702, 29697764, 29797055, 30348145, 30592353, 31241241, 31350836, 31353158, 31359595, 31479745		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28630212, 29578185		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	26936111		★☆☆☆☆ Found in Text Mining only
Creatine deficiency, X-linked	Creatine deficiency	BEFREE	27466184		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	31557250	Associate	★☆☆☆☆ Found in Text Mining only
Cyclic neutropenia	Cyclic Neutropenia	BEFREE	28770174		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	11799280		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	11160347, 23233327, 29652658		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28064113, 29805602		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	28727277		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	27862715, 29449893, 29625702		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	27862715, 29362719, 29449893, 29625702		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	28406068	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	28406068, 32572159	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28599667, 31428057		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	29147614		★☆☆☆☆ Found in Text Mining only
Disruptive, Impulse Control, and Conduct Disorders	Impulse control disorder	BEFREE	28427578, 30874886		★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	28503875		★☆☆☆☆ Found in Text Mining only
Distal myopathy Nonaka type	Distal myopathy	Pubtator	23472144	Associate	★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	18417548, 22415851		★☆☆☆☆ Found in Text Mining only
Endocarditis	Endocarditis	BEFREE	31151718		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	28938593, 29844817, 31783195		★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	28228150		★☆☆☆☆ Found in Text Mining only
Epiretinal Membrane	Epiretinal Membrane	BEFREE	29115893		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	22773372, 28245631, 28260038		★☆☆☆☆ Found in Text Mining only
Esophageal Achalasia	Achalasia	BEFREE	17009399		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	22214381, 25231404, 27001344, 27429017, 28767597, 29343986, 30311162, 30447937, 30867781, 31222680		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	22214381, 25231404, 27001344, 27429017, 28767597, 29343986, 30311162, 30447937, 30867781, 31222680		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	36907982	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	29138861	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophagitis	Esotropia	Pubtator	17131471	Associate	★☆☆☆☆ Found in Text Mining only
Esophagitis	Esophagitis	BEFREE	25784564		★☆☆☆☆ Found in Text Mining only
Essential thrombocythemia	Thrombocythemia	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Essential Tremor	Essential tremor	Pubtator	24957246, 25573593, 25716342, 25858548, 29741776, 30404086, 31610612, 31710700, 32745264, 32929772, 34514582, 35672563, 36000955, 36266510	Associate	★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	29502232		★☆☆☆☆ Found in Text Mining only
Fecal Incontinence	Bowel incontinence	BEFREE	28304143		★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	29147879		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	25619450		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	16951181, 22293781, 29160038, 29374810, 29443896		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	16951181, 22293781, 29160038, 29374810, 29443896		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	16951181		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23082878, 29916141		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34472223, 38554294	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	29115893		★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	31142442	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	10205590		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	28091874, 29256329, 29895020, 31109689		★☆☆☆☆ Found in Text Mining only
Heart Block	Heart Block	BEFREE	28863179		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	29952146	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	23736534, 27338764, 27862715, 28003221, 28383431, 28427578, 28653309, 28688704, 28846805, 29086228, 29151496, 29525386, 29625702, 29697764, 29797055, 30348145, 30592353, 31241241, 31350836, 31359595, 31479745		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	24036084, 32323496	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart valve disease	Cardiac valvular disease	BEFREE	23465222, 29466958		★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	26596525	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	25696868, 26640226, 29364275		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	30577887	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	CGI_DG			★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	15934438, 27686171, 30655313		★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	BEFREE	18045552		★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	9234244	Associate	★☆☆☆☆ Found in Text Mining only
HEMOCHROMATOSIS, TYPE 1	Hemochromatosis	BEFREE	18045552		★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	29160038		★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia a	Pubtator	32128578	Associate	★☆☆☆☆ Found in Text Mining only
Hemophilia, NOS	Hemophilia	BEFREE	29160038		★☆☆☆☆ Found in Text Mining only
Hepatic Vein Thrombosis	Hepatic Vein Thrombosis	BEFREE	29803161		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	34706936	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	18045552		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	30246353, 30708133		★☆☆☆☆ Found in Text Mining only
Hypergammaglobulinemia	Hypergammaglobulinemia	BEFREE	30561748		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30471633		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	29106577		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	17959730	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	32323496	Stimulate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	31612071		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	19881547		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29559014, 30067866		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	29773794		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	17563366	Associate	★☆☆☆☆ Found in Text Mining only
Insulin resistance - type A	Insulin resistance syndrome	BEFREE	17563366		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	27466184, 30635645		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	25368235		★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	29627954, 29697764, 31165517		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	26583143		★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	25858548		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	30471633		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	36054308	Associate	★☆☆☆☆ Found in Text Mining only
Left Bundle-Branch Block	Left Bundle-Branch Block	BEFREE	27885751, 27989791, 28416247, 28427578, 28608184, 28688704, 29064041, 29625702, 30538769, 31492516		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	15326310, 21368877, 25305205, 26377485, 27686378, 27740635, 27875935, 34911786, 36744404	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	25176567, 27686378, 28028029, 28507789, 29769311		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	32995942	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	25858548	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	15326310, 15855281, 19659458, 21368877, 21471526, 26377485, 27802968, 30991860, 33536020, 34300032, 39300580, 40557150	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	22915645	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Neutrophilic Chronic	Neutrophilic leukemia	Pubtator	25316523, 33822276	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15326310, 15855281, 19659458, 22915645, 25858548, 26640226, 27802968, 28507789, 31340059, 31555600, 31582537		★☆☆☆☆ Found in Text Mining only
Leukemia, Myeloid, Chronic, Atypical, BCR-ABL Negative	Myeloid Leukemia	BEFREE	24627528		★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	22429966		★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	36464833	Associate	★☆☆☆☆ Found in Text Mining only
Liposarcoma, Dedifferentiated	liposarcoma	BEFREE	22429966		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16762624, 28676383, 29098144, 30062844, 31374039		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	16762624		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	17959730	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	28652209, 28863179		★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	29670135		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	16645621, 29800456		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35264066	Associate	★☆☆☆☆ Found in Text Mining only
Lupus anticoagulant disorder	Lupus anticoagulant	BEFREE	30777133		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	11115162, 14698275, 23832290, 29265023		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	16645988	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	23535532	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	14698275, 23832290, 29265023		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	12410797, 14698275, 21078628, 21167895, 23832290, 28565882, 28851621, 29265023, 29274781, 30178506, 30777133, 31674268, 3230562, 6334744, 6392551, 6980631, 8495261, 9065775		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	24741600, 28565882, 30403595		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	14698275, 23832290, 29265023		★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	22990013	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	30882006		★☆☆☆☆ Found in Text Mining only
Macular retinal edema	Macular edema	BEFREE	28266152		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	16951181		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	28091874, 29256329, 31109689		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21133637, 22393307, 27788031, 28454292, 29042925, 29138861, 29151967, 29306221, 29434859, 30404664, 30592274, 30723582, 31365118, 31788104		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	29844817, 31783195		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	22214381, 25231404, 27001344, 27429017, 28767597, 28893415, 29343986, 30311162, 30447937, 30867781, 31222680		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28302866, 28916844		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	31509615		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	15289361, 24264800, 29072694, 30333867		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	14612551, 19608864, 22385796, 23075580, 28013228, 28373447, 29052565, 29151227, 30053596, 31694438, 31721011, 31808397		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17566973		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19050968, 31118042, 31725767		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	28960621		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	24593306, 29989024		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18765291, 20010869, 21836485, 22193987, 22508478, 23019653, 23378602, 24325359, 25044096, 25314065, 25918716, 25963547, 26951227, 27658891, 28079009, 28304143, 28411309, 28470469, 28507789, 28599487, 28676668, 28938427, 28974414, 29160038, 29175313, 29274781, 29383986, 29441976, 29844798, 30080874, 30097573, 30579890, 30655313, 30929105, 31171903, 31428057, 31468151, 31568485, 31655327, 31707642, 31729028, 31788104		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	17146630, 23715898, 30217165		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19881547, 27026680, 30265426, 30398409, 31789933		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	31656644		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	29147614		★☆☆☆☆ Found in Text Mining only
Mastocytosis, Systemic	Mastocytosis	BEFREE	29466766		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10360639, 20960187, 30282994		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	14732231		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28064113, 29805602		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	22507216		★☆☆☆☆ Found in Text Mining only
Mental Retardation, X-Linked	Mental retardation	BEFREE	22751104		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	30441807		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	29748013	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	28383431, 29449893		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	14732231		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	38168863	Stimulate	★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	18801343		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	36338146, 36606310	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	38178798	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	31741139		★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	25858548, 31741139		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	CGI_DG			★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	32929772	Associate	★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	ORPHANET_DG	24325256, 24325359		★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	GENOMICS_ENGLAND_DG	24325359		★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	24888274, 25193869, 25870379, 25934766, 26355403, 26449662, 26460248, 26890983, 27013444, 27124925, 27427771, 27693531, 28161773, 28168700, 28714945, 29123956, 29160038, 29282219, 29515114, 29515238, 29534592, 30498775, 30615982, 30745304, 30846848, 30889303, 31340059, 31630335		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	26754830, 29466766		★☆☆☆☆ Found in Text Mining only
Myeloperoxidase Deficiency	Myeloperoxidase Deficiency	BEFREE	27013444		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	24325356, 24325359, 24371211, 24553179, 24618731, 24740812, 24786775, 24849893, 24895336, 25023898, 25068507, 25115511, 25139710, 25151955, 25323779, 25349114, 25482455, 25499808, 25553276, 25849990, 25858548, 25860380, 25870379, 25951317, 25976465, 26071474, 26227853, 26375990, 26449662, 26460248, 26486738, 26486739, 26501981, 26555437, 26596525, 26754830, 26817954, 26951227, 27018326, 27039813, 27061303, 27114372, 27124925, 27177927, 27185380, 27258562, 27354406, 27384487, 27423004, 27427771, 27447873, 27662324, 27686170, 27693531, 27716741, 27727468, 27807369, 27840830, 27855276, 27875935, 28031530, 28161773, 28168700, 28228104, 28340692, 28406068, 28411309, 28422716, 28470469, 28556926, 28589084, 28625126, 28741795, 28990497, 29042365, 29164670, 29258411, 29277359, 29288169, 29306106, 29364275, 29464483, 29617043, 29727699, 29741776, 29769311, 29803161, 29946189, 30001747, 30084272, 30295334, 30327655, 30429377, 30594750, 30606612, 30655313, 30846848, 30902807, 30929105, 31071164, 31135094, 31248375, 31266769, 31270458, 31332222, 31369569, 31377025, 31462733, 31562135, 31626697, 31697806, 31710700, 31810292, 31848992		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	CTD_human_DG	29047144		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	24371211, 25858548, 29192651, 31697806, 32002304, 35405004, 35743246	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	27757734		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	HPO_DG			★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	28329280		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myositis Inclusion Body	Myositis	Pubtator	14695312	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28055973, 28107202, 28342002, 28515352, 28943965, 29100451, 29344223, 29389048, 29718841, 29885997, 30864463, 31200353, 31632490, 31737097		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	28107202	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10933198, 14985791, 15280455, 15668290, 16107858, 16645621, 17146630, 18401437, 18812201, 19608864, 20736329, 20960187, 22430888, 22700466, 22773372, 23546299, 23648458, 24060004, 24264800, 24925057, 24997628, 25044096, 25863743, 25918716, 26221725, 26391562, 26431835, 27139600, 27572313, 27672742, 28034064, 28106543, 28339788, 28454292, 28492521, 28507789, 28599487, 28621318, 28714529, 28723863, 28759121, 28778674, 28894229, 28978067, 29075268, 29217398, 29274781, 29358668, 29476017, 29769311, 29989024, 30053596, 30223802, 30327655, 30394654, 30482226, 30510949, 30579890, 30606612, 30612140, 31048664, 31171903, 31208359, 31275386, 31516597, 31530419, 31626697, 31632490, 31697806, 31747968		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	25368235		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	31377025		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	31017385		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	24325359	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	15668290, 20736329, 21723904, 25288151, 30612140		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	15668290, 36644580, 37947594	Associate	★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	30635645		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	16293970, 30084687, 31492994		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	29100451		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28034064, 29228584, 29703705, 29858023, 29945024, 31809876		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	21182888, 21723904, 22507216		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonorganic psychosis	Nonorganic Psychosis	PSYGENET_DG	21182888, 22507216		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	18567819, 21266224, 28274171	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	25963547, 29278718, 30382603		★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 1	Oculocutaneous albinism	BEFREE	15677452		★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	28980718		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	38169377	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28106543, 29844798		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	28106543, 30816440	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	31509615		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31747968	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Serous Adenocarcinoma	Ovarian serous adenocarcinoma	BEFREE	24060004		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	15289361, 24264800, 29072694, 30333867		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	29274781		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	29072694		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	27561105	Associate	★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	28515303		★☆☆☆☆ Found in Text Mining only
Paranoid Schizophrenia	Paranoid Schizophrenia	PSYGENET_DG	18801343		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	24321043	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28261073		★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	25963547		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	21108646		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	30484267		★☆☆☆☆ Found in Text Mining only
Piebaldism	Piebaldism	BEFREE	28228150		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	24060004		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	23883183		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	24325356, 24553179, 25015052, 25116092, 25189723, 25305205, 25849990, 25860380, 26182311, 26355403, 26402369, 26450985, 26961933, 27037840, 27039813, 27486987, 28228104, 28232234, 28402197, 28406068, 28948454, 29194068, 29515238, 29975001, 31208359, 31248375		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	25305205, 27132877, 27486987, 28228104, 28232234, 28990497, 29599206, 30889303, 31668145, 33789164, 34911786, 36744404, 38111518, 38386293	Associate	★☆☆☆☆ Found in Text Mining only
Polyp of large intestine	Polyp Of Large Intestine	BEFREE	27663716		★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	HPO_DG			★☆☆☆☆ Found in Text Mining only
Portal Vein Thrombosis	Portal Vein Thrombosis	BEFREE	29803161		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	29115545		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	29364275		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	30138085		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	ORPHANET_DG	24325256, 24325359		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Primary myelofibrosis	Myelofibrosis	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Primary Myelofibrosis	Myelofibrosis	BEFREE	24325356, 24402162, 24441292, 24496303, 24553179, 24618731, 24849893, 24888274, 24895336, 24957246, 24986690, 24997152, 25015052, 25037629, 25068507, 25116092, 25176567, 25193869, 25305205, 25729726, 25746303, 25860380, 25870379, 25934766, 25959795, 26130950, 26182311, 26227853, 26355403, 26375990, 26402369, 26449662, 26460248, 26697989, 26832847, 26890983, 26935576, 27013444, 27039813, 27061303, 27067982, 27124925, 27185380, 27427771, 27486987, 27570091, 27693531, 27727468, 27756071, 27807369, 28143941, 28161773, 28168700, 28185911, 28340692, 28415571, 28422716, 28676668, 28714945, 28778261, 28948454, 28948488, 28990497, 29034885, 29047144, 29123956, 29160038, 29164670, 29282219, 29464483, 29515114, 29515238, 29534592, 29560522, 29665657, 29907810, 29946821, 30039550, 30080988, 30259659, 30343103, 30498775, 30502850, 30606612, 30615982, 30745304, 30846848, 30889303, 31208359, 31248375, 31340059, 31369569, 31371984, 31471561, 31478923, 31630335, 31848992		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Primary Myelofibrosis	Myelofibrosis	GENOMICS_ENGLAND_DG	24325359		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Primary Myelofibrosis	Myelofibrosis	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Primary Myelofibrosis	Myelofibrosis	HPO_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Primary Myelofibrosis	Myelofibrosis	CTD_human_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Prostate carcinoma	Prostate cancer	BEFREE	14612551, 19608864, 22385796, 23075580, 28013228, 28373447, 29052565, 29151227, 30053596, 31694438, 31721011, 31808397		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17566973		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	19608864		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19820934	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	34350063	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	BEFREE	21182888, 21723904, 22507216		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	PSYGENET_DG	21182888, 22507216		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rectal Carcinoma	Rectal Carcinoma	BEFREE	27510332, 28934968, 30181716, 30359718, 30901357, 31127991, 31229791, 31273449, 31373223, 31702618		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28630212, 29578185		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	27345266, 30651822		★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	31377025		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	24884814	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	29318471		★☆☆☆☆ Found in Text Mining only
Rhegmatogenous retinal detachment	Rhegmatogenous retinal detachment	BEFREE	31129751		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	23233327, 28652209, 29652658, 30045972, 30639474, 31119302, 3865340		★☆☆☆☆ Found in Text Mining only
Right bundle branch block	Bundle Branch Block	BEFREE	30538769		★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	38051221	Associate	★☆☆☆☆ Found in Text Mining only
Schizoaffective Disorder	Schizoaffective Disorder	BEFREE	18801343, 19760677		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizoaffective Disorder	Schizoaffective Disorder	PSYGENET_DG	18801343, 19760677		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	16511840		★☆☆☆☆ Found in Text Mining only
secondary acute myeloid leukemia	Myeloid leukemia	BEFREE	29034885		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	31612071		★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	BEFREE	15078946		★☆☆☆☆ Found in Text Mining only
Shared Paranoid Disorder	Shared Paranoid Disorder	BEFREE	22507216		★☆☆☆☆ Found in Text Mining only
Shared Paranoid Disorder	Shared Paranoid Disorder	PSYGENET_DG	22507216		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	29945024		★☆☆☆☆ Found in Text Mining only
Speech Disorders	Speech Disorders	BEFREE	27466184, 30635645		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	30518112		★☆☆☆☆ Found in Text Mining only
Splanchnic vein thrombosis	Splanchnic vein thrombosis	BEFREE	25173966, 28483676, 29803161		★☆☆☆☆ Found in Text Mining only
Splenomegaly	Splenomegaly	Pubtator	24997152, 36744404	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	26255977, 27429017, 28599487		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	19684620, 23814025, 24907633, 25863743, 28457536, 29138861, 29477349, 30395362, 30922343, 31048664		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	CTD_human_DG	21517111		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	34580365	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	30194767		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	30211118, 31749055		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19050968, 31118042, 31725767		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26745502, 28423550, 31725767, 34112882	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27624754	Stimulate	★☆☆☆☆ Found in Text Mining only
Supraventricular tachycardia	Supraventricular tachycardia	BEFREE	25173966, 28483676, 29803161, 31711259		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	28449713		★☆☆☆☆ Found in Text Mining only
Tachycardia, Ventricular	Ventricular tachycardia	BEFREE	27629147, 27886920, 29030235, 29186401		★☆☆☆☆ Found in Text Mining only
THROMBOCYTHEMIA 1	Thrombocythemia	GENOMICS_ENGLAND_DG	24325359		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
THROMBOCYTHEMIA 1	Thrombocythemia	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	24325356, 24366362, 24371211, 24553179, 24618731, 24627549, 24753125, 24786775, 24895336, 25037629, 25068507, 25139350, 25637689, 25729726, 25860380, 25934766, 25959795, 26130950, 26375990, 26377485, 26449662, 26486786, 26501981, 26890983, 27100794, 27132877, 27175028, 27185380, 27341002, 27352261, 27384487, 27453224, 27486987, 27693531, 27855276, 27875935, 27991718, 28031530, 28406068, 28415571, 28422716, 28990497, 29217833, 29521158, 30080988, 30157297, 30281843, 30889303, 31332222, 31515250, 31554376, 31668145, 31697806, 31868244, 32425934, 32572159, 32745264, 33444113, 33599741, 34300032, 34333533, 34911786, 35633552, 35754115, 35945607, 36104197, 36606310, 36744404, 36979444, 36990774, 37525276, 37550636, 38111518, 38238287, 38238303, 38252902, 38386293, 38404143, 39337361, 40474352	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	ORPHANET_DG	24325256, 24325359		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombocythemia, Essential	Thrombocythemia	BEFREE	24371211, 24402162, 24441292, 24535932, 24553179, 24618731, 24627549, 24753125, 24791854, 24849893, 24889737, 24895336, 24957246, 25015052, 25037629, 25068507, 25116092, 25139350, 25189723, 25259626, 25305205, 25447704, 25540065, 25573593, 25611051, 25729726, 25746303, 25849990, 25858548, 25860380, 25934766, 25959795, 25976465, 26130950, 26294037, 26355403, 26370832, 26375990, 26402369, 26449662, 26450985, 26460248, 26486786, 26501981, 26555437, 26573090, 26614694, 26650457, 26697989, 26754830, 26890983, 26961933, 27013444, 27037840, 27039813, 27041108, 27061303, 27067982, 27100794, 27124925, 27132877, 27175028, 27185380, 27271054, 27341002, 27427771, 27453224, 27486987, 27521277, 27570091, 27686171, 27693531, 27716741, 27734130, 27807369, 27855276, 27875935, 27909216, 28143941, 28168700, 28205126, 28228104, 28340692, 28406068, 28415571, 28422716, 28450924, 28503875, 28589084, 28676668, 28948454, 28948488, 28990497, 29047144, 29160038, 29194068, 29217833, 29282219, 29306106, 29390868, 29411299, 29464483, 29521158, 29560522, 29617043, 29741776, 29934356, 29975001, 30074114, 30080988, 30292681, 30404086, 30502850, 30558676, 30606612, 30624802, 30671215, 30846848, 30926777, 30971335, 31250082, 31332222, 31471561, 31478923, 31479555, 31515250, 31626697, 31710700, 31848992		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombocythemia, Essential	Thrombocythemia	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombocytopenia	Thrombocytopenia	Pubtator	24986690	Inhibit	★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	35576311	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	BEFREE	24371211, 26754830, 27114372, 27139600, 27175028, 27716741, 28450924, 28589084, 29282219, 29411299, 30846848, 30926777, 31710700, 31848992		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombocytosis	Thrombocytosis	Pubtator	24371211, 25023898, 26573090, 27139600, 27855276, 30292681, 31710700, 32425934, 33789164, 35129130, 37240094, 38238287, 38238303, 40474352, 40572650	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombocytosis	Thrombocytosis	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombocytosis, Autosomal Dominant	Thrombocytosis	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Thromboembolism	Thromboembolism	Pubtator	37813367	Inhibit	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	24325356, 24553179, 25573593, 25729726, 26449662, 27453224, 27486987, 34300032, 35754115, 36744404	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	24371211, 24627549, 24986690, 29217833, 31868244	Inhibit	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	BEFREE	10205590		★☆☆☆☆ Found in Text Mining only
Tomaculous neuropathy	Hereditary neuropathy with liability to pressure palsies	Pubtator	31868244	Associate	★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	HPO_DG			★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	6605702		★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	BEFREE	27293069		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24986690, 37762557, 38238287	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31423253		★☆☆☆☆ Found in Text Mining only
Type II Mucolipidosis	Mucolipidosis	BEFREE	28427578, 30874886		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	15596044, 19756593, 24573199, 34930465	Associate	★☆☆☆☆ Found in Text Mining only
Usher Syndromes	Usher syndrome	Pubtator	33835720	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	23024775	Inhibit	★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	1463604		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	27423004		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	27570091		★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	24895336, 38238303	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	29016821, 31241241		★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular Fibrillation	BEFREE	27886920, 29186401		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	23771121		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	23771121	Stimulate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	38246583	Associate	★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	23771121		★☆☆☆☆ Found in Text Mining only