Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	81029
Gene name	Wnt family member 5B
Gene symbol	WNT5B
Synonyms (NCBI Gene)	-
Chromosome	12
Chromosome location	12p13.33
Summary	The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryog

148

Show/Hide all (148)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022886	hsa-miR-124-3p	Microarray	18668037
MIRT045371	hsa-miR-185-5p	CLASH	23622248
MIRT1493833	hsa-miR-1275	CLIP-seq
MIRT1493834	hsa-miR-1324	CLIP-seq
MIRT1493835	hsa-miR-144	CLIP-seq
MIRT1493836	hsa-miR-1910	CLIP-seq
MIRT1493837	hsa-miR-2682	CLIP-seq
MIRT1493838	hsa-miR-3124-3p	CLIP-seq
MIRT1493839	hsa-miR-3138	CLIP-seq
MIRT1493840	hsa-miR-3165	CLIP-seq
MIRT1493841	hsa-miR-3185	CLIP-seq
MIRT1493842	hsa-miR-3605-5p	CLIP-seq
MIRT1493843	hsa-miR-3909	CLIP-seq
MIRT1493844	hsa-miR-4271	CLIP-seq
MIRT1493845	hsa-miR-4447	CLIP-seq
MIRT1493846	hsa-miR-4472	CLIP-seq
MIRT1493847	hsa-miR-449c	CLIP-seq
MIRT1493848	hsa-miR-4514	CLIP-seq
MIRT1493849	hsa-miR-4520a-3p	CLIP-seq
MIRT1493850	hsa-miR-4525	CLIP-seq
MIRT1493851	hsa-miR-4532	CLIP-seq
MIRT1493852	hsa-miR-4645-3p	CLIP-seq
MIRT1493853	hsa-miR-4651	CLIP-seq
MIRT1493854	hsa-miR-4665-5p	CLIP-seq
MIRT1493855	hsa-miR-4692	CLIP-seq
MIRT1493856	hsa-miR-4723-5p	CLIP-seq
MIRT1493857	hsa-miR-4725-3p	CLIP-seq
MIRT1493858	hsa-miR-4787-5p	CLIP-seq
MIRT1493859	hsa-miR-513a-5p	CLIP-seq
MIRT1493860	hsa-miR-568	CLIP-seq
MIRT1493861	hsa-miR-587	CLIP-seq
MIRT1493862	hsa-miR-608	CLIP-seq
MIRT1493863	hsa-miR-625	CLIP-seq
MIRT1493864	hsa-miR-7	CLIP-seq
MIRT1493865	hsa-miR-765	CLIP-seq
MIRT1493866	hsa-miR-1224-3p	CLIP-seq
MIRT1493867	hsa-miR-1260	CLIP-seq
MIRT1493868	hsa-miR-1260b	CLIP-seq
MIRT1493833	hsa-miR-1275	CLIP-seq
MIRT1493869	hsa-miR-1280	CLIP-seq
MIRT1493870	hsa-miR-146b-3p	CLIP-seq
MIRT1493871	hsa-miR-150	CLIP-seq
MIRT1493872	hsa-miR-339-5p	CLIP-seq
MIRT1493844	hsa-miR-4271	CLIP-seq
MIRT1493873	hsa-miR-4421	CLIP-seq
MIRT1493845	hsa-miR-4447	CLIP-seq
MIRT1493846	hsa-miR-4472	CLIP-seq
MIRT1493850	hsa-miR-4525	CLIP-seq
MIRT1493851	hsa-miR-4532	CLIP-seq
MIRT1493852	hsa-miR-4645-3p	CLIP-seq
MIRT1493853	hsa-miR-4651	CLIP-seq
MIRT1493854	hsa-miR-4665-5p	CLIP-seq
MIRT1493874	hsa-miR-4707-5p	CLIP-seq
MIRT1493875	hsa-miR-4713-5p	CLIP-seq
MIRT1493856	hsa-miR-4723-5p	CLIP-seq
MIRT1493857	hsa-miR-4725-3p	CLIP-seq
MIRT1493858	hsa-miR-4787-5p	CLIP-seq
MIRT1493876	hsa-miR-532-3p	CLIP-seq
MIRT1493862	hsa-miR-608	CLIP-seq
MIRT1493863	hsa-miR-625	CLIP-seq
MIRT1493864	hsa-miR-7	CLIP-seq
MIRT2369219	hsa-miR-3689d	CLIP-seq
MIRT2369220	hsa-miR-4497	CLIP-seq
MIRT2397027	hsa-miR-4756-3p	CLIP-seq
MIRT2434841	hsa-miR-300	CLIP-seq
MIRT2434842	hsa-miR-3121-3p	CLIP-seq
MIRT2434843	hsa-miR-3163	CLIP-seq
MIRT2434844	hsa-miR-381	CLIP-seq
MIRT2434845	hsa-miR-4666-3p	CLIP-seq
MIRT2434846	hsa-miR-4789-5p	CLIP-seq
MIRT2463553	hsa-miR-1272	CLIP-seq
MIRT2463554	hsa-miR-143	CLIP-seq
MIRT2434841	hsa-miR-300	CLIP-seq
MIRT2434842	hsa-miR-3121-3p	CLIP-seq
MIRT2434843	hsa-miR-3163	CLIP-seq
MIRT2463555	hsa-miR-3663-3p	CLIP-seq
MIRT2434844	hsa-miR-381	CLIP-seq
MIRT2434845	hsa-miR-4666-3p	CLIP-seq
MIRT2397027	hsa-miR-4756-3p	CLIP-seq
MIRT2463556	hsa-miR-4770	CLIP-seq
MIRT2434846	hsa-miR-4789-5p	CLIP-seq
MIRT2463557	hsa-miR-486-3p	CLIP-seq
MIRT2463553	hsa-miR-1272	CLIP-seq
MIRT2463554	hsa-miR-143	CLIP-seq
MIRT2463555	hsa-miR-3663-3p	CLIP-seq
MIRT2397027	hsa-miR-4756-3p	CLIP-seq
MIRT2463556	hsa-miR-4770	CLIP-seq
MIRT2463557	hsa-miR-486-3p	CLIP-seq
MIRT2662907	hsa-miR-105	CLIP-seq
MIRT2662908	hsa-miR-1238	CLIP-seq
MIRT1493833	hsa-miR-1275	CLIP-seq
MIRT1493835	hsa-miR-144	CLIP-seq
MIRT2662909	hsa-miR-15a	CLIP-seq
MIRT2662910	hsa-miR-15b	CLIP-seq
MIRT2662911	hsa-miR-16	CLIP-seq
MIRT2662912	hsa-miR-195	CLIP-seq
MIRT2662913	hsa-miR-2277-3p	CLIP-seq
MIRT2662914	hsa-miR-28-5p	CLIP-seq
MIRT1493838	hsa-miR-3124-3p	CLIP-seq
MIRT2662915	hsa-miR-3139	CLIP-seq
MIRT2662916	hsa-miR-3606	CLIP-seq
MIRT2662917	hsa-miR-424	CLIP-seq
MIRT1493844	hsa-miR-4271	CLIP-seq
MIRT2662918	hsa-miR-4313	CLIP-seq
MIRT1493845	hsa-miR-4447	CLIP-seq
MIRT1493846	hsa-miR-4472	CLIP-seq
MIRT1493850	hsa-miR-4525	CLIP-seq
MIRT1493851	hsa-miR-4532	CLIP-seq
MIRT2662919	hsa-miR-4633-3p	CLIP-seq
MIRT1493852	hsa-miR-4645-3p	CLIP-seq
MIRT1493853	hsa-miR-4651	CLIP-seq
MIRT2662920	hsa-miR-4660	CLIP-seq
MIRT1493854	hsa-miR-4665-5p	CLIP-seq
MIRT1493874	hsa-miR-4707-5p	CLIP-seq
MIRT1493856	hsa-miR-4723-5p	CLIP-seq
MIRT1493857	hsa-miR-4725-3p	CLIP-seq
MIRT1493858	hsa-miR-4787-5p	CLIP-seq
MIRT2662921	hsa-miR-497	CLIP-seq
MIRT1493862	hsa-miR-608	CLIP-seq
MIRT1493863	hsa-miR-625	CLIP-seq
MIRT2662922	hsa-miR-646	CLIP-seq
MIRT1493864	hsa-miR-7	CLIP-seq
MIRT2662923	hsa-miR-708	CLIP-seq
MIRT1493865	hsa-miR-765	CLIP-seq
MIRT2662907	hsa-miR-105	CLIP-seq
MIRT2662908	hsa-miR-1238	CLIP-seq
MIRT2662909	hsa-miR-15a	CLIP-seq
MIRT2662910	hsa-miR-15b	CLIP-seq
MIRT2662911	hsa-miR-16	CLIP-seq
MIRT2662912	hsa-miR-195	CLIP-seq
MIRT2695296	hsa-miR-2114	CLIP-seq
MIRT2662913	hsa-miR-2277-3p	CLIP-seq
MIRT2662914	hsa-miR-28-5p	CLIP-seq
MIRT1493838	hsa-miR-3124-3p	CLIP-seq
MIRT2662915	hsa-miR-3139	CLIP-seq
MIRT2695297	hsa-miR-3162-3p	CLIP-seq
MIRT2662916	hsa-miR-3606	CLIP-seq
MIRT2695298	hsa-miR-3691-3p	CLIP-seq
MIRT2662917	hsa-miR-424	CLIP-seq
MIRT2662918	hsa-miR-4313	CLIP-seq
MIRT2662919	hsa-miR-4633-3p	CLIP-seq
MIRT1493852	hsa-miR-4645-3p	CLIP-seq
MIRT2662920	hsa-miR-4660	CLIP-seq
MIRT2695299	hsa-miR-4793-5p	CLIP-seq
MIRT2662921	hsa-miR-497	CLIP-seq
MIRT2662922	hsa-miR-646	CLIP-seq
MIRT2662923	hsa-miR-708	CLIP-seq
MIRT1493865	hsa-miR-765	CLIP-seq

Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002062	Process	Chondrocyte differentiation	IEP	15135146
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	IPI	19486338
GO:0005109	Function	Frizzled binding	IBA
GO:0005125	Function	Cytokine activity	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	NAS	15135146
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0009986	Component	Cell surface	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0030182	Process	Neuron differentiation	IBA
GO:0030182	Process	Neuron differentiation	ISS
GO:0030335	Process	Positive regulation of cell migration	IDA	19486338
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0031012	Component	Extracellular matrix	HDA	28327460
GO:0031012	Component	Extracellular matrix	IEA
GO:0042692	Process	Muscle cell differentiation	ISS
GO:0045165	Process	Cell fate commitment	IBA
GO:0045444	Process	Fat cell differentiation	NAS	19577541
GO:0045600	Process	Positive regulation of fat cell differentiation	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070062	Component	Extracellular exosome	TAS
GO:0070307	Process	Lens fiber cell development	ISS	16258938
GO:0071300	Process	Cellular response to retinoic acid	ISS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:1904105	Process	Positive regulation of convergent extension involved in gastrulation	ISS
GO:2000052	Process	Positive regulation of non-canonical Wnt signaling pathway	ISS

MIM	HGNC	e!Ensembl
606361	16265	ENSG00000111186

Q9H1J7

Protein name

Protein Wnt-5b

Protein function

Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameter

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00110	wnt	50 → 359	wnt family	Family

Sequence

MPSLLLLFTAALLSSWAQLLTDANSWWSLALNPVQRPEMFIIGAQPVCSQLPGLSPGQRK
LCQLYQEHMAYIGEGAKTGIKECQHQFRQRRWNCSTADNASVFGRVMQIGSRETAFTHAV
SAAGVVNAISRACREGELSTCGCSRTARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDARE
REKNFAKGSEEQGRVLMNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRK
VGDRLKEKYDSAAAMRVTRKGRLELVNSRFTQPTPEDLVYVDPSPDYCLRNESTGSLGTQ
GRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCKFHWCCFVRCKKCTEIVDQYICK

Sequence length

359

Interactions

View interactions

	KEGG		Reactome
	mTOR signaling pathway Wnt signaling pathway Axon guidance Hippo signaling pathway Signaling pathways regulating pluripotency of stem cells Melanogenesis Cushing syndrome Alzheimer disease Pathways of neurodegeneration - multiple diseases Human papillomavirus infection Pathways in cancer Proteoglycans in cancer Basal cell carcinoma Breast cancer Hepatocellular carcinoma Gastric cancer		WNT ligand biogenesis and trafficking PCP/CE pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, ADENOID CYSTIC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIAPHRAGM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEIOMYOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SALIVARY GLAND NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (41)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31666682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	CTD_human_DG	16762588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	GWASCAT_DG	22179738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	20068183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	17900349	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17510243, 29847788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29847788, 31462314	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19849855, 24944491	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33804101	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	25663376	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27121420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	15386214, 18555673, 19577541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	15972578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	LHGDN	15972578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	CTD_human_DG	15972578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Goldenhar Syndrome	Goldenhar Syndrome	BEFREE	19733267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	GWASCAT_DG	22179738		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	BEFREE	31666682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	27593938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17510243, 29847788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of salivary gland	Malignant neoplasm of salivary gland	CTD_human_DG	16762588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27121420, 27762090, 31666682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17510243, 27593938		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	21144913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	18555673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	32561739	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	17900349, 22820497	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	BEFREE	22820497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	17295923	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30055306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	19486338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	21980461, 27036869, 27126693	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	CTD_human_DG	16762588		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Systemic	Systemic sclerosis	Pubtator	37587067	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24220306, 27593938, 31666682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	21998657, 26861993	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	21998657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24564888	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	15972578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	CTD_human_DG	15972578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	27126693	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

WNT5B (Wnt family member 5B)