Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8099
Gene name	Cyclin dependent kinase 2 associated protein 1
Gene symbol	CDK2AP1
Synonyms (NCBI Gene)	DOC1DORC1ST19doc-1p12DOC-1
Chromosome	12
Chromosome location	12q24.31
Summary	The protein encoded by this gene is a cyclin-dependent kinase 2 (CDK2) -associated protein which is thought to negatively regulate CDK2 activity by sequestering monomeric CDK2, and targeting CDK2 for proteolysis. This protein was found to also interact wi

310

Show/Hide all (310)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005974	hsa-miR-21-5p	Luciferase reporter assayqRT-PCRWestern blot	21328460
MIRT005974	hsa-miR-21-5p	Luciferase reporter assayqRT-PCRWestern blot	21328460
MIRT005974	hsa-miR-21-5p	Reporter assay	21328460
MIRT040895	hsa-miR-18a-3p	CLASH	23622248
MIRT880975	hsa-miR-1253	CLIP-seq
MIRT880976	hsa-miR-1258	CLIP-seq
MIRT880977	hsa-miR-1285	CLIP-seq
MIRT880978	hsa-miR-1292	CLIP-seq
MIRT880979	hsa-miR-1297	CLIP-seq
MIRT880980	hsa-miR-139-5p	CLIP-seq
MIRT880981	hsa-miR-183	CLIP-seq
MIRT880982	hsa-miR-1973	CLIP-seq
MIRT880983	hsa-miR-2053	CLIP-seq
MIRT880984	hsa-miR-21	CLIP-seq
MIRT880985	hsa-miR-26a	CLIP-seq
MIRT880986	hsa-miR-26b	CLIP-seq
MIRT880987	hsa-miR-297	CLIP-seq
MIRT880988	hsa-miR-300	CLIP-seq
MIRT880989	hsa-miR-3133	CLIP-seq
MIRT880990	hsa-miR-3149	CLIP-seq
MIRT880991	hsa-miR-3162-3p	CLIP-seq
MIRT880992	hsa-miR-3180-5p	CLIP-seq
MIRT880993	hsa-miR-3182	CLIP-seq
MIRT880994	hsa-miR-3187-5p	CLIP-seq
MIRT880995	hsa-miR-323-3p	CLIP-seq
MIRT880996	hsa-miR-338-5p	CLIP-seq
MIRT880997	hsa-miR-3591-3p	CLIP-seq
MIRT880998	hsa-miR-3612	CLIP-seq
MIRT880999	hsa-miR-3613-3p	CLIP-seq
MIRT881000	hsa-miR-3647-3p	CLIP-seq
MIRT881001	hsa-miR-3662	CLIP-seq
MIRT881002	hsa-miR-3686	CLIP-seq
MIRT881003	hsa-miR-381	CLIP-seq
MIRT881004	hsa-miR-3940-5p	CLIP-seq
MIRT881005	hsa-miR-4255	CLIP-seq
MIRT881006	hsa-miR-4307	CLIP-seq
MIRT881007	hsa-miR-431	CLIP-seq
MIRT881008	hsa-miR-4311	CLIP-seq
MIRT881009	hsa-miR-432	CLIP-seq
MIRT881010	hsa-miR-4328	CLIP-seq
MIRT881011	hsa-miR-4443	CLIP-seq
MIRT881012	hsa-miR-4464	CLIP-seq
MIRT881013	hsa-miR-4465	CLIP-seq
MIRT881014	hsa-miR-4470	CLIP-seq
MIRT881015	hsa-miR-4471	CLIP-seq
MIRT881016	hsa-miR-4503	CLIP-seq
MIRT881017	hsa-miR-4507	CLIP-seq
MIRT881018	hsa-miR-4659a-3p	CLIP-seq
MIRT881019	hsa-miR-4659b-3p	CLIP-seq
MIRT881020	hsa-miR-4662a-3p	CLIP-seq
MIRT881021	hsa-miR-4666-3p	CLIP-seq
MIRT881022	hsa-miR-4668-3p	CLIP-seq
MIRT881023	hsa-miR-4670-3p	CLIP-seq
MIRT881024	hsa-miR-4699-5p	CLIP-seq
MIRT881025	hsa-miR-4711-3p	CLIP-seq
MIRT881026	hsa-miR-4742-3p	CLIP-seq
MIRT881027	hsa-miR-4748	CLIP-seq
MIRT881028	hsa-miR-4787-5p	CLIP-seq
MIRT881029	hsa-miR-490-3p	CLIP-seq
MIRT881030	hsa-miR-495	CLIP-seq
MIRT881031	hsa-miR-499-3p	CLIP-seq
MIRT881032	hsa-miR-499a-3p	CLIP-seq
MIRT881033	hsa-miR-517b	CLIP-seq
MIRT881034	hsa-miR-518a-3p	CLIP-seq
MIRT881035	hsa-miR-518b	CLIP-seq
MIRT881036	hsa-miR-518c	CLIP-seq
MIRT881037	hsa-miR-518d-3p	CLIP-seq
MIRT881038	hsa-miR-518f	CLIP-seq
MIRT881039	hsa-miR-520a-5p	CLIP-seq
MIRT881040	hsa-miR-520d-5p	CLIP-seq
MIRT881041	hsa-miR-524-5p	CLIP-seq
MIRT881042	hsa-miR-525-5p	CLIP-seq
MIRT881043	hsa-miR-541	CLIP-seq
MIRT881044	hsa-miR-548ac	CLIP-seq
MIRT881045	hsa-miR-548c-3p	CLIP-seq
MIRT881046	hsa-miR-548d-3p	CLIP-seq
MIRT881047	hsa-miR-548o	CLIP-seq
MIRT881048	hsa-miR-548z	CLIP-seq
MIRT881049	hsa-miR-555	CLIP-seq
MIRT881050	hsa-miR-556-3p	CLIP-seq
MIRT881051	hsa-miR-569	CLIP-seq
MIRT881052	hsa-miR-582-5p	CLIP-seq
MIRT881053	hsa-miR-590-5p	CLIP-seq
MIRT881054	hsa-miR-600	CLIP-seq
MIRT881055	hsa-miR-605	CLIP-seq
MIRT881056	hsa-miR-606	CLIP-seq
MIRT881057	hsa-miR-612	CLIP-seq
MIRT881058	hsa-miR-615-5p	CLIP-seq
MIRT881059	hsa-miR-650	CLIP-seq
MIRT881060	hsa-miR-654-5p	CLIP-seq
MIRT880978	hsa-miR-1292	CLIP-seq
MIRT881014	hsa-miR-4470	CLIP-seq
MIRT881015	hsa-miR-4471	CLIP-seq
MIRT880976	hsa-miR-1258	CLIP-seq
MIRT1960983	hsa-miR-127-5p	CLIP-seq
MIRT880978	hsa-miR-1292	CLIP-seq
MIRT880980	hsa-miR-139-5p	CLIP-seq
MIRT880981	hsa-miR-183	CLIP-seq
MIRT880982	hsa-miR-1973	CLIP-seq
MIRT1960984	hsa-miR-205	CLIP-seq
MIRT880984	hsa-miR-21	CLIP-seq
MIRT880987	hsa-miR-297	CLIP-seq
MIRT880988	hsa-miR-300	CLIP-seq
MIRT880989	hsa-miR-3133	CLIP-seq
MIRT880990	hsa-miR-3149	CLIP-seq
MIRT880991	hsa-miR-3162-3p	CLIP-seq
MIRT880993	hsa-miR-3182	CLIP-seq
MIRT880997	hsa-miR-3591-3p	CLIP-seq
MIRT880998	hsa-miR-3612	CLIP-seq
MIRT880999	hsa-miR-3613-3p	CLIP-seq
MIRT881002	hsa-miR-3686	CLIP-seq
MIRT881003	hsa-miR-381	CLIP-seq
MIRT881005	hsa-miR-4255	CLIP-seq
MIRT881007	hsa-miR-431	CLIP-seq
MIRT881009	hsa-miR-432	CLIP-seq
MIRT881011	hsa-miR-4443	CLIP-seq
MIRT881012	hsa-miR-4464	CLIP-seq
MIRT881014	hsa-miR-4470	CLIP-seq
MIRT881015	hsa-miR-4471	CLIP-seq
MIRT881016	hsa-miR-4503	CLIP-seq
MIRT881018	hsa-miR-4659a-3p	CLIP-seq
MIRT881019	hsa-miR-4659b-3p	CLIP-seq
MIRT881020	hsa-miR-4662a-3p	CLIP-seq
MIRT881021	hsa-miR-4666-3p	CLIP-seq
MIRT881022	hsa-miR-4668-3p	CLIP-seq
MIRT881025	hsa-miR-4711-3p	CLIP-seq
MIRT1960985	hsa-miR-4718	CLIP-seq
MIRT1960986	hsa-miR-4720-3p	CLIP-seq
MIRT1960987	hsa-miR-4738-3p	CLIP-seq
MIRT881026	hsa-miR-4742-3p	CLIP-seq
MIRT881027	hsa-miR-4748	CLIP-seq
MIRT881028	hsa-miR-4787-5p	CLIP-seq
MIRT1960988	hsa-miR-4804-3p	CLIP-seq
MIRT881030	hsa-miR-495	CLIP-seq
MIRT1960989	hsa-miR-500a	CLIP-seq
MIRT881033	hsa-miR-517b	CLIP-seq
MIRT881034	hsa-miR-518a-3p	CLIP-seq
MIRT881035	hsa-miR-518b	CLIP-seq
MIRT881036	hsa-miR-518c	CLIP-seq
MIRT881037	hsa-miR-518d-3p	CLIP-seq
MIRT881038	hsa-miR-518f	CLIP-seq
MIRT1960990	hsa-miR-548aa	CLIP-seq
MIRT881045	hsa-miR-548c-3p	CLIP-seq
MIRT1960991	hsa-miR-548g	CLIP-seq
MIRT881047	hsa-miR-548o	CLIP-seq
MIRT1960992	hsa-miR-548p	CLIP-seq
MIRT881049	hsa-miR-555	CLIP-seq
MIRT881052	hsa-miR-582-5p	CLIP-seq
MIRT881053	hsa-miR-590-5p	CLIP-seq
MIRT881054	hsa-miR-600	CLIP-seq
MIRT881055	hsa-miR-605	CLIP-seq
MIRT881058	hsa-miR-615-5p	CLIP-seq
MIRT1960993	hsa-miR-633	CLIP-seq
MIRT1960994	hsa-miR-643	CLIP-seq
MIRT881059	hsa-miR-650	CLIP-seq
MIRT880976	hsa-miR-1258	CLIP-seq
MIRT1960983	hsa-miR-127-5p	CLIP-seq
MIRT880978	hsa-miR-1292	CLIP-seq
MIRT880980	hsa-miR-139-5p	CLIP-seq
MIRT880981	hsa-miR-183	CLIP-seq
MIRT880982	hsa-miR-1973	CLIP-seq
MIRT880984	hsa-miR-21	CLIP-seq
MIRT880987	hsa-miR-297	CLIP-seq
MIRT880988	hsa-miR-300	CLIP-seq
MIRT880989	hsa-miR-3133	CLIP-seq
MIRT880990	hsa-miR-3149	CLIP-seq
MIRT880991	hsa-miR-3162-3p	CLIP-seq
MIRT880992	hsa-miR-3180-5p	CLIP-seq
MIRT880995	hsa-miR-323-3p	CLIP-seq
MIRT880997	hsa-miR-3591-3p	CLIP-seq
MIRT880999	hsa-miR-3613-3p	CLIP-seq
MIRT881003	hsa-miR-381	CLIP-seq
MIRT881004	hsa-miR-3940-5p	CLIP-seq
MIRT881005	hsa-miR-4255	CLIP-seq
MIRT881006	hsa-miR-4307	CLIP-seq
MIRT881008	hsa-miR-4311	CLIP-seq
MIRT881010	hsa-miR-4328	CLIP-seq
MIRT881012	hsa-miR-4464	CLIP-seq
MIRT881014	hsa-miR-4470	CLIP-seq
MIRT881015	hsa-miR-4471	CLIP-seq
MIRT881016	hsa-miR-4503	CLIP-seq
MIRT881017	hsa-miR-4507	CLIP-seq
MIRT881018	hsa-miR-4659a-3p	CLIP-seq
MIRT881019	hsa-miR-4659b-3p	CLIP-seq
MIRT881020	hsa-miR-4662a-3p	CLIP-seq
MIRT881021	hsa-miR-4666-3p	CLIP-seq
MIRT881022	hsa-miR-4668-3p	CLIP-seq
MIRT881023	hsa-miR-4670-3p	CLIP-seq
MIRT1960985	hsa-miR-4718	CLIP-seq
MIRT1960986	hsa-miR-4720-3p	CLIP-seq
MIRT881027	hsa-miR-4748	CLIP-seq
MIRT881028	hsa-miR-4787-5p	CLIP-seq
MIRT1960988	hsa-miR-4804-3p	CLIP-seq
MIRT881030	hsa-miR-495	CLIP-seq
MIRT881033	hsa-miR-517b	CLIP-seq
MIRT881034	hsa-miR-518a-3p	CLIP-seq
MIRT881035	hsa-miR-518b	CLIP-seq
MIRT881036	hsa-miR-518c	CLIP-seq
MIRT881037	hsa-miR-518d-3p	CLIP-seq
MIRT881038	hsa-miR-518f	CLIP-seq
MIRT881039	hsa-miR-520a-5p	CLIP-seq
MIRT881042	hsa-miR-525-5p	CLIP-seq
MIRT881043	hsa-miR-541	CLIP-seq
MIRT881047	hsa-miR-548o	CLIP-seq
MIRT1960992	hsa-miR-548p	CLIP-seq
MIRT881049	hsa-miR-555	CLIP-seq
MIRT881052	hsa-miR-582-5p	CLIP-seq
MIRT881053	hsa-miR-590-5p	CLIP-seq
MIRT881054	hsa-miR-600	CLIP-seq
MIRT881055	hsa-miR-605	CLIP-seq
MIRT881058	hsa-miR-615-5p	CLIP-seq
MIRT1960993	hsa-miR-633	CLIP-seq
MIRT881060	hsa-miR-654-5p	CLIP-seq
MIRT880978	hsa-miR-1292	CLIP-seq
MIRT880980	hsa-miR-139-5p	CLIP-seq
MIRT880981	hsa-miR-183	CLIP-seq
MIRT880987	hsa-miR-297	CLIP-seq
MIRT880990	hsa-miR-3149	CLIP-seq
MIRT880995	hsa-miR-323-3p	CLIP-seq
MIRT881014	hsa-miR-4470	CLIP-seq
MIRT881015	hsa-miR-4471	CLIP-seq
MIRT881016	hsa-miR-4503	CLIP-seq
MIRT881023	hsa-miR-4670-3p	CLIP-seq
MIRT881052	hsa-miR-582-5p	CLIP-seq
MIRT881054	hsa-miR-600	CLIP-seq
MIRT880993	hsa-miR-3182	CLIP-seq
MIRT881002	hsa-miR-3686	CLIP-seq
MIRT881004	hsa-miR-3940-5p	CLIP-seq
MIRT881017	hsa-miR-4507	CLIP-seq
MIRT881018	hsa-miR-4659a-3p	CLIP-seq
MIRT881019	hsa-miR-4659b-3p	CLIP-seq
MIRT881026	hsa-miR-4742-3p	CLIP-seq
MIRT881043	hsa-miR-541	CLIP-seq
MIRT881052	hsa-miR-582-5p	CLIP-seq
MIRT881060	hsa-miR-654-5p	CLIP-seq
MIRT2501024	hsa-miR-105	CLIP-seq
MIRT2501025	hsa-miR-1183	CLIP-seq
MIRT880976	hsa-miR-1258	CLIP-seq
MIRT1960983	hsa-miR-127-5p	CLIP-seq
MIRT2501026	hsa-miR-143	CLIP-seq
MIRT1960984	hsa-miR-205	CLIP-seq
MIRT2501027	hsa-miR-3175	CLIP-seq
MIRT880993	hsa-miR-3182	CLIP-seq
MIRT2501028	hsa-miR-3672	CLIP-seq
MIRT881002	hsa-miR-3686	CLIP-seq
MIRT2501029	hsa-miR-3688-3p	CLIP-seq
MIRT881004	hsa-miR-3940-5p	CLIP-seq
MIRT881005	hsa-miR-4255	CLIP-seq
MIRT2501030	hsa-miR-4426	CLIP-seq
MIRT881012	hsa-miR-4464	CLIP-seq
MIRT2501031	hsa-miR-4480	CLIP-seq
MIRT881016	hsa-miR-4503	CLIP-seq
MIRT881017	hsa-miR-4507	CLIP-seq
MIRT2501032	hsa-miR-4539	CLIP-seq
MIRT2501033	hsa-miR-4647	CLIP-seq
MIRT881018	hsa-miR-4659a-3p	CLIP-seq
MIRT881019	hsa-miR-4659b-3p	CLIP-seq
MIRT2501034	hsa-miR-4662b	CLIP-seq
MIRT1960986	hsa-miR-4720-3p	CLIP-seq
MIRT881026	hsa-miR-4742-3p	CLIP-seq
MIRT881027	hsa-miR-4748	CLIP-seq
MIRT2501035	hsa-miR-4770	CLIP-seq
MIRT881028	hsa-miR-4787-5p	CLIP-seq
MIRT1960988	hsa-miR-4804-3p	CLIP-seq
MIRT1960989	hsa-miR-500a	CLIP-seq
MIRT881043	hsa-miR-541	CLIP-seq
MIRT881045	hsa-miR-548c-3p	CLIP-seq
MIRT881047	hsa-miR-548o	CLIP-seq
MIRT1960992	hsa-miR-548p	CLIP-seq
MIRT2501036	hsa-miR-570	CLIP-seq
MIRT881052	hsa-miR-582-5p	CLIP-seq
MIRT881058	hsa-miR-615-5p	CLIP-seq
MIRT1960993	hsa-miR-633	CLIP-seq
MIRT1960994	hsa-miR-643	CLIP-seq
MIRT881060	hsa-miR-654-5p	CLIP-seq
MIRT2501024	hsa-miR-105	CLIP-seq
MIRT880976	hsa-miR-1258	CLIP-seq
MIRT1960983	hsa-miR-127-5p	CLIP-seq
MIRT1960984	hsa-miR-205	CLIP-seq
MIRT880993	hsa-miR-3182	CLIP-seq
MIRT880999	hsa-miR-3613-3p	CLIP-seq
MIRT881002	hsa-miR-3686	CLIP-seq
MIRT2501029	hsa-miR-3688-3p	CLIP-seq
MIRT881004	hsa-miR-3940-5p	CLIP-seq
MIRT881005	hsa-miR-4255	CLIP-seq
MIRT2501030	hsa-miR-4426	CLIP-seq
MIRT881012	hsa-miR-4464	CLIP-seq
MIRT881016	hsa-miR-4503	CLIP-seq
MIRT881017	hsa-miR-4507	CLIP-seq
MIRT2501032	hsa-miR-4539	CLIP-seq
MIRT2501033	hsa-miR-4647	CLIP-seq
MIRT881018	hsa-miR-4659a-3p	CLIP-seq
MIRT881019	hsa-miR-4659b-3p	CLIP-seq
MIRT2501034	hsa-miR-4662b	CLIP-seq
MIRT1960986	hsa-miR-4720-3p	CLIP-seq
MIRT881026	hsa-miR-4742-3p	CLIP-seq
MIRT881027	hsa-miR-4748	CLIP-seq
MIRT881028	hsa-miR-4787-5p	CLIP-seq
MIRT1960988	hsa-miR-4804-3p	CLIP-seq
MIRT1960989	hsa-miR-500a	CLIP-seq
MIRT881043	hsa-miR-541	CLIP-seq
MIRT1960990	hsa-miR-548aa	CLIP-seq
MIRT881045	hsa-miR-548c-3p	CLIP-seq
MIRT881047	hsa-miR-548o	CLIP-seq
MIRT2501036	hsa-miR-570	CLIP-seq
MIRT881052	hsa-miR-582-5p	CLIP-seq
MIRT881058	hsa-miR-615-5p	CLIP-seq
MIRT1960993	hsa-miR-633	CLIP-seq
MIRT1960994	hsa-miR-643	CLIP-seq
MIRT881060	hsa-miR-654-5p	CLIP-seq

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IDA	20523938
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	9506968
GO:0005515	Function	Protein binding	IPI	14985111, 21516116, 24248101, 25416956, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	9506968, 20523938, 28977666, 33283408
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005829	Component	Cytosol	IDA
GO:0006261	Process	DNA-templated DNA replication	NAS	9506968
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	20523938
GO:0016581	Component	NuRD complex	IDA	20523938, 33283408
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	9506968
GO:0070182	Function	DNA polymerase binding	IPI	9506968

MIM	HGNC	e!Ensembl
602198	14002	ENSG00000111328

O14519

Protein name

Cyclin-dependent kinase 2-associated protein 1 (CDK2-associated protein 1) (Deleted in oral cancer 1) (DOC-1) (Putative oral cancer suppressor)

Protein function

Inhibitor of cyclin-dependent kinase CDK2 (By similarity). Also acts as a component of the histone deacetylase NuRD complex which participates in the remodeling of chromatin (PubMed:16428440, PubMed:20523938, PubMed:28977666). {ECO:0000250|UniPr

PDB

2KW6

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09806	CDK2AP	3 → 114	Cyclin-dependent kinase 2-associated protein	Family

Sequence

MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQ
SKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS

Sequence length

115

Interactions

View interactions

	KEGG
	ATP-dependent chromatin remodeling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL ALLERGIC RHINITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (40)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Allergic rhinitis (disorder)	Allergic rhinitis	GWASCAT_DG	30013184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	19585490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30878151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30343278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30343278	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	22791769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	20541561	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	8314147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	13679870, 14761923, 15806176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	13679870, 17689689		★★★★★ ★☆☆☆☆ Found in Text Mining only
COMBINED OXIDATIVE PHOSPHORYLATION DEFICIENCY 7	Combined Oxidative Phosphorylation Deficiency	CLINVAR_DG	20598281, 24284555, 27858754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epileptic encephalopathy	Epileptic encephalopathy	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibromyxosarcoma	Fibromyxosarcoma	BEFREE	24889487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroenteritis	Gastroenteritis	BEFREE	26933058, 28783750, 29487214, 30645593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	24620959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	22791769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	26515287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	28683324, 9331572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	22791769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30343278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	28683324, 9331572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	8314147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19585490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24620959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	37217493	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	20555355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Atrophy Spinal	Spinal muscular atrophy	Pubtator	23299920	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	22791769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	13679870, 20541561, 22791769, 22900064, 24620959, 30343278, 9331572		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	8314147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	29229992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19585490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25785833, 36362115, 36613831	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia	Spastic Paraplegia	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
SPASTIC PARAPLEGIA 55, AUTOSOMAL RECESSIVE	Spastic Paraplegia	CLINVAR_DG	20598281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	30246859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	20541561, 21328460, 21740085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	17217620, 26515287	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25785833, 28683324, 37217493	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25785833	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only

CDK2AP1 (cyclin dependent kinase 2 associated protein 1)