HMGA2 (high mobility group AT-hook 2)

Gene

• Entrez ID: 8091
• Gene name: High mobility group AT-hook 2
• Gene symbol: HMGA2
• Synonyms (NCBI Gene): BABL, HMGI-C, HMGIC, LIPO, SRS5, STQTL9
• Chromosome: 12
• Chromosome location: 12q14.3
• Summary: This gene encodes a protein that belongs to the non-histone chromosomal high mobility group (HMG) protein family. HMG proteins function as architectural factors and are essential components of the enhancesome. This protein contains structural DNA-binding

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT002323	hsa-let-7a-5p	qRT-PCR, Western blot	17600087
MIRT002322	hsa-let-7c-5p	qRT-PCR, Western blot	17600087
MIRT002097	hsa-let-7g-5p	Western blot	18413726
MIRT002097	hsa-let-7g-5p	Luciferase reporter assay, Western blot, qRT-PCR	17600087
MIRT002097	hsa-let-7g-5p	Luciferase reporter assay, Western blot, qRT-PCR	17600087
MIRT002097	hsa-let-7g-5p	Luciferase reporter assay, Western blot, qRT-PCR	17600087
MIRT002097	hsa-let-7g-5p	Luciferase reporter assay, Western blot, qRT-PCR	17600087
MIRT002097	hsa-let-7g-5p	Luciferase reporter assay, Western blot, qRT-PCR	17600087
MIRT002097	hsa-let-7g-5p	Luciferase reporter assay, Western blot, qRT-PCR	17600087
MIRT002097	hsa-let-7g-5p	Luciferase reporter assay, Western blot, qRT-PCR	17600087
MIRT002005	hsa-let-7d-5p	Luciferase reporter assay	17600087
MIRT002005	hsa-let-7d-5p	Luciferase reporter assay	17600087
MIRT002005	hsa-let-7d-5p	Luciferase reporter assay	17600087
MIRT002005	hsa-let-7d-5p	Luciferase reporter assay	17600087
MIRT002005	hsa-let-7d-5p	Luciferase reporter assay	17600087
MIRT002005	hsa-let-7d-5p	Luciferase reporter assay	17600087
MIRT002005	hsa-let-7d-5p	Luciferase reporter assay	17600087
MIRT002322	hsa-let-7c-5p	Luciferase reporter assay, qRT-PCR, Western blot	18403645
MIRT000748	hsa-miR-34a-5p	Review, Microarray	19461653
MIRT002005	hsa-let-7d-5p	qRT-PCR, ChIP, Luciferase reporter assay	20395557
MIRT002323	hsa-let-7a-5p	Luciferase reporter assay	18413822
MIRT002323	hsa-let-7a-5p	Luciferase reporter assay	17322030
MIRT002323	hsa-let-7a-5p	Luciferase reporter assay	17600087
MIRT002323	hsa-let-7a-5p	Luciferase reporter assay	18083101
MIRT002322	hsa-let-7c-5p	Luciferase reporter assay	18403645
MIRT002322	hsa-let-7c-5p	Luciferase reporter assay	17600087
MIRT002097	hsa-let-7g-5p	Luciferase reporter assay	18308936
MIRT002097	hsa-let-7g-5p	Luciferase reporter assay	17600087
MIRT000348	hsa-miR-125b-5p	Luciferase reporter assay	17563749
MIRT000109	hsa-miR-26a-5p	Luciferase reporter assay	17563749
MIRT002323	hsa-let-7a-5p	Luciferase reporter assay	19179606
MIRT003713	hsa-miR-370-3p	Luciferase reporter assay	19179606
MIRT002323	hsa-let-7a-5p	Western blot	19179606
MIRT002323	hsa-let-7a-5p	Review	20144549
MIRT002082	hsa-let-7b-5p	Review	20144549
MIRT002322	hsa-let-7c-5p	Review	20144549
MIRT002999	hsa-miR-98-5p	Review	20130964
MIRT002323	hsa-let-7a-5p	Luciferase reporter assay, qRT-PCR, Western blot	19179606
MIRT002323	hsa-let-7a-5p	Luciferase reporter assay, qRT-PCR, Western blot	19179606
MIRT004702	hsa-miR-185-5p	Flow, Immunoblot, Microarray, qRT-PCR	19688090
MIRT002999	hsa-miR-98-5p	Northern blot, qRT-PCR	17222355
MIRT002999	hsa-miR-98-5p	Northern blot, qRT-PCR	17222355
MIRT002082	hsa-let-7b-5p	Luciferase reporter assay, qRT-PCR	17437991
MIRT002082	hsa-let-7b-5p	Luciferase reporter assay, qRT-PCR	17437991
MIRT002082	hsa-let-7b-5p	Luciferase reporter assay, qRT-PCR	17437991
MIRT002082	hsa-let-7b-5p	Luciferase reporter assay, qRT-PCR	17437991
MIRT002082	hsa-let-7b-5p	Luciferase reporter assay, qRT-PCR	17437991
MIRT002082	hsa-let-7b-5p	Luciferase reporter assay, qRT-PCR	17437991
MIRT002081	hsa-let-7e-5p	Luciferase reporter assay, qRT-PCR	17437991
MIRT002081	hsa-let-7e-5p	Luciferase reporter assay, qRT-PCR	17437991
MIRT002081	hsa-let-7e-5p	Luciferase reporter assay, qRT-PCR	17437991
MIRT002081	hsa-let-7e-5p	Luciferase reporter assay, qRT-PCR	17437991
MIRT002081	hsa-let-7e-5p	Luciferase reporter assay, qRT-PCR	17437991
MIRT002081	hsa-let-7e-5p	Luciferase reporter assay, qRT-PCR	17437991
MIRT002322	hsa-let-7c-5p	Microarray, Northern blot, qRT-PCR, Western blot	17243163
MIRT002005	hsa-let-7d-5p	Western blot	17957144
MIRT002322	hsa-let-7c-5p	Immunocytochemistry, Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	21224353
MIRT006054	hsa-miR-29b-3p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	21224353
MIRT002322	hsa-let-7c-5p	Immunocytochemistry, Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	21224353
MIRT006054	hsa-miR-29b-3p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	21224353
MIRT002322	hsa-let-7c-5p	Immunocytochemistry, Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	21224353
MIRT006054	hsa-miR-29b-3p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	21224353
MIRT002323	hsa-let-7a-5p	Luciferase reporter assay, qRT-PCR, Western blot	22139073
MIRT006803	hsa-miR-196a-5p	Luciferase reporter assay, qRT-PCR, Western blot	22139073
MIRT000109	hsa-miR-26a-5p	Luciferase reporter assay, qRT-PCR, Western blot	22139073
MIRT006804	hsa-miR-16-5p	Luciferase reporter assay, qRT-PCR, Western blot	22139073
MIRT006805	hsa-miR-15a-5p	Luciferase reporter assay, qRT-PCR, Western blot	22139073
MIRT002097	hsa-let-7g-5p	Reporter assay	18413726
MIRT002999	hsa-miR-98-5p	Microarray	19088304
MIRT002999	hsa-miR-98-5p	Western blot;Other	17222355
MIRT002323	hsa-let-7a-5p	CLASH	23622248
MIRT002322	hsa-let-7c-5p	CLASH	23622248
MIRT051403	hsa-let-7f-5p	CLASH	23622248
MIRT036768	hsa-miR-760	CLASH	23622248
MIRT036768	hsa-miR-760	CLASH	23622248
MIRT000109	hsa-miR-26a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24853416
MIRT000109	hsa-miR-26a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24853416
MIRT053326	hsa-miR-154-5p	Luciferase reporter assay, qRT-PCR, Western blot	23591597
MIRT053326	hsa-miR-154-5p	Luciferase reporter assay, qRT-PCR, Western blot	23591597
MIRT002082	hsa-let-7b-5p	Immunohistochemistry, Luciferase reporter assay, QRTPCR, Western blot	23482325
MIRT002323	hsa-let-7a-5p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24617339
MIRT002082	hsa-let-7b-5p	Luciferase reporter assay	23318420
MIRT002005	hsa-let-7d-5p	Luciferase reporter assay	23318420
MIRT002097	hsa-let-7g-5p	Luciferase reporter assay	23318420
MIRT437833	hsa-miR-145-5p	Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	25444913
MIRT437833	hsa-miR-145-5p	Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	25444913
MIRT066499	hsa-miR-33a-5p	Luciferase reporter assay, Western blot	23625920
MIRT066499	hsa-miR-33a-5p	Luciferase reporter assay, Western blot	23625920
MIRT066499	hsa-miR-33a-5p	Luciferase reporter assay, Western blot	23625920
MIRT066499	hsa-miR-33a-5p	Luciferase reporter assay, Western blot	23625920
MIRT066499	hsa-miR-33a-5p	Luciferase reporter assay, Western blot	23625920
MIRT066499	hsa-miR-33a-5p	Luciferase reporter assay, Western blot	23625920
MIRT066499	hsa-miR-33a-5p	Luciferase reporter assay, Western blot	23625920
MIRT066499	hsa-miR-33a-5p	Luciferase reporter assay, Western blot	23625920
MIRT438260	hsa-miR-23b-3p	Luciferase reporter assay	24681352
MIRT000109	hsa-miR-26a-5p	Luciferase reporter assay	24682444
MIRT002999	hsa-miR-98-5p	Luciferase reporter assay, Western blot	24392454
MIRT002999	hsa-miR-98-5p	Luciferase reporter assay, Western blot	24392454
MIRT438260	hsa-miR-23b-3p	Luciferase reporter assay	24681352
MIRT000109	hsa-miR-26a-5p	Luciferase reporter assay	24682444
MIRT002999	hsa-miR-98-5p	Luciferase reporter assay, Western blot	24392454
MIRT002999	hsa-miR-98-5p	Luciferase reporter assay, Western blot	24392454
MIRT002082	hsa-let-7b-5p	HITS-CLIP	21572407
MIRT002322	hsa-let-7c-5p	HITS-CLIP	21572407
MIRT002005	hsa-let-7d-5p	HITS-CLIP	21572407
MIRT002081	hsa-let-7e-5p	HITS-CLIP	21572407
MIRT051403	hsa-let-7f-5p	HITS-CLIP	21572407
MIRT002097	hsa-let-7g-5p	HITS-CLIP	21572407
MIRT066476	hsa-let-7i-5p	HITS-CLIP	21572407
MIRT066487	hsa-miR-4458	HITS-CLIP	21572407
MIRT002323	hsa-let-7a-5p	HITS-CLIP	21572407
MIRT066489	hsa-miR-4500	HITS-CLIP	21572407
MIRT002999	hsa-miR-98-5p	HITS-CLIP	21572407
MIRT066479	hsa-miR-196b-5p	HITS-CLIP	21572407
MIRT006803	hsa-miR-196a-5p	HITS-CLIP	21572407
MIRT507024	hsa-miR-6766-3p	HITS-CLIP	21572407
MIRT507023	hsa-miR-4782-3p	HITS-CLIP	21572407
MIRT507022	hsa-miR-219a-5p	HITS-CLIP	21572407
MIRT066518	hsa-miR-142-3p	HITS-CLIP	21572407
MIRT066530	hsa-miR-3529-3p	HITS-CLIP	21572407
MIRT507021	hsa-miR-1244	HITS-CLIP	21572407
MIRT066528	hsa-miR-648	HITS-CLIP	21572407
MIRT066527	hsa-miR-508-3p	HITS-CLIP	21572407
MIRT507020	hsa-miR-4445-5p	HITS-CLIP	21572407
MIRT066442	hsa-miR-3199	HITS-CLIP	21572407
MIRT066450	hsa-miR-8052	HITS-CLIP	21572407
MIRT274478	hsa-miR-365a-5p	HITS-CLIP	21572407
MIRT274479	hsa-miR-365b-5p	HITS-CLIP	21572407
MIRT066529	hsa-miR-2052	HITS-CLIP	21572407
MIRT507019	hsa-miR-19a-5p	HITS-CLIP	21572407
MIRT507018	hsa-miR-19b-1-5p	HITS-CLIP	21572407
MIRT507017	hsa-miR-19b-2-5p	HITS-CLIP	21572407
MIRT066526	hsa-let-7c-3p	HITS-CLIP	21572407
MIRT507016	hsa-let-7a-2-3p	HITS-CLIP	21572407
MIRT507015	hsa-let-7g-3p	HITS-CLIP	21572407
MIRT507014	hsa-miR-493-5p	HITS-CLIP	21572407
MIRT507024	hsa-miR-6766-3p	PAR-CLIP	20371350
MIRT507023	hsa-miR-4782-3p	PAR-CLIP	20371350
MIRT507022	hsa-miR-219a-5p	PAR-CLIP	20371350
MIRT006803	hsa-miR-196a-5p	PAR-CLIP	20371350
MIRT066479	hsa-miR-196b-5p	PAR-CLIP	20371350
MIRT002097	hsa-let-7g-5p	PAR-CLIP	20371350
MIRT051403	hsa-let-7f-5p	PAR-CLIP	20371350
MIRT002005	hsa-let-7d-5p	PAR-CLIP	20371350
MIRT066489	hsa-miR-4500	PAR-CLIP	20371350
MIRT066476	hsa-let-7i-5p	PAR-CLIP	20371350
MIRT066487	hsa-miR-4458	PAR-CLIP	20371350
MIRT002081	hsa-let-7e-5p	PAR-CLIP	20371350
MIRT002999	hsa-miR-98-5p	PAR-CLIP	20371350
MIRT002323	hsa-let-7a-5p	PAR-CLIP	20371350
MIRT002322	hsa-let-7c-5p	PAR-CLIP	20371350
MIRT002082	hsa-let-7b-5p	PAR-CLIP	20371350
MIRT066530	hsa-miR-3529-3p	PAR-CLIP	20371350
MIRT507021	hsa-miR-1244	PAR-CLIP	20371350
MIRT066528	hsa-miR-648	PAR-CLIP	20371350
MIRT066527	hsa-miR-508-3p	PAR-CLIP	20371350
MIRT507020	hsa-miR-4445-5p	PAR-CLIP	20371350
MIRT066442	hsa-miR-3199	PAR-CLIP	20371350
MIRT066450	hsa-miR-8052	PAR-CLIP	20371350
MIRT274478	hsa-miR-365a-5p	PAR-CLIP	20371350
MIRT274479	hsa-miR-365b-5p	PAR-CLIP	20371350
MIRT066518	hsa-miR-142-3p	PAR-CLIP	20371350
MIRT066529	hsa-miR-2052	PAR-CLIP	20371350
MIRT507019	hsa-miR-19a-5p	PAR-CLIP	20371350
MIRT507018	hsa-miR-19b-1-5p	PAR-CLIP	20371350
MIRT507017	hsa-miR-19b-2-5p	PAR-CLIP	20371350
MIRT066526	hsa-let-7c-3p	PAR-CLIP	20371350
MIRT507016	hsa-let-7a-2-3p	PAR-CLIP	20371350
MIRT507015	hsa-let-7g-3p	PAR-CLIP	20371350
MIRT507014	hsa-miR-493-5p	PAR-CLIP	20371350
MIRT066474	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT066473	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT066481	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT066475	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT066477	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT066478	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT557277	hsa-miR-543	PAR-CLIP	21572407
MIRT557276	hsa-miR-181a-5p	PAR-CLIP	21572407
MIRT557275	hsa-miR-181b-5p	PAR-CLIP	21572407
MIRT557274	hsa-miR-181c-5p	PAR-CLIP	21572407
MIRT557273	hsa-miR-181d-5p	PAR-CLIP	21572407
MIRT557272	hsa-miR-4262	PAR-CLIP	21572407
MIRT066482	hsa-miR-1296-3p	PAR-CLIP	21572407
MIRT066488	hsa-miR-4461	PAR-CLIP	21572407
MIRT066496	hsa-miR-6847-5p	PAR-CLIP	21572407
MIRT066485	hsa-miR-4257	PAR-CLIP	21572407
MIRT557271	hsa-miR-4450	PAR-CLIP	21572407
MIRT066480	hsa-miR-491-5p	PAR-CLIP	21572407
MIRT557270	hsa-miR-3143	PAR-CLIP	21572407
MIRT066490	hsa-miR-4727-3p	PAR-CLIP	21572407
MIRT066498	hsa-miR-6869-5p	PAR-CLIP	21572407
MIRT066497	hsa-miR-6857-5p	PAR-CLIP	21572407
MIRT066479	hsa-miR-196b-5p	PAR-CLIP	23446348
MIRT006803	hsa-miR-196a-5p	PAR-CLIP	23446348
MIRT507024	hsa-miR-6766-3p	PAR-CLIP	23446348
MIRT507023	hsa-miR-4782-3p	PAR-CLIP	23446348
MIRT507022	hsa-miR-219a-5p	PAR-CLIP	23446348
MIRT066518	hsa-miR-142-3p	PAR-CLIP	23446348
MIRT066530	hsa-miR-3529-3p	PAR-CLIP	23446348
MIRT507021	hsa-miR-1244	PAR-CLIP	23446348
MIRT066528	hsa-miR-648	PAR-CLIP	23446348
MIRT066527	hsa-miR-508-3p	PAR-CLIP	23446348
MIRT507020	hsa-miR-4445-5p	PAR-CLIP	23446348
MIRT066442	hsa-miR-3199	PAR-CLIP	23446348
MIRT066450	hsa-miR-8052	PAR-CLIP	23446348
MIRT274478	hsa-miR-365a-5p	PAR-CLIP	23446348
MIRT274479	hsa-miR-365b-5p	PAR-CLIP	23446348
MIRT066529	hsa-miR-2052	PAR-CLIP	23446348
MIRT507019	hsa-miR-19a-5p	PAR-CLIP	23446348
MIRT507018	hsa-miR-19b-1-5p	PAR-CLIP	23446348
MIRT507017	hsa-miR-19b-2-5p	PAR-CLIP	23446348
MIRT066526	hsa-let-7c-3p	PAR-CLIP	23446348
MIRT507016	hsa-let-7a-2-3p	PAR-CLIP	23446348
MIRT507015	hsa-let-7g-3p	PAR-CLIP	23446348
MIRT507014	hsa-miR-493-5p	PAR-CLIP	23446348
MIRT066479	hsa-miR-196b-5p	PAR-CLIP	23446348
MIRT006803	hsa-miR-196a-5p	PAR-CLIP	23446348
MIRT507024	hsa-miR-6766-3p	PAR-CLIP	23446348
MIRT507023	hsa-miR-4782-3p	PAR-CLIP	23446348
MIRT507022	hsa-miR-219a-5p	PAR-CLIP	23446348
MIRT066530	hsa-miR-3529-3p	PAR-CLIP	23446348
MIRT507021	hsa-miR-1244	PAR-CLIP	23446348
MIRT066528	hsa-miR-648	PAR-CLIP	23446348
MIRT066527	hsa-miR-508-3p	PAR-CLIP	23446348
MIRT507020	hsa-miR-4445-5p	PAR-CLIP	23446348
MIRT274478	hsa-miR-365a-5p	PAR-CLIP	23446348
MIRT274479	hsa-miR-365b-5p	PAR-CLIP	23446348
MIRT066518	hsa-miR-142-3p	PAR-CLIP	23446348
MIRT066529	hsa-miR-2052	PAR-CLIP	23446348
MIRT507019	hsa-miR-19a-5p	PAR-CLIP	23446348
MIRT507018	hsa-miR-19b-1-5p	PAR-CLIP	23446348
MIRT507017	hsa-miR-19b-2-5p	PAR-CLIP	23446348
MIRT066526	hsa-let-7c-3p	PAR-CLIP	23446348
MIRT507016	hsa-let-7a-2-3p	PAR-CLIP	23446348
MIRT507015	hsa-let-7g-3p	PAR-CLIP	23446348
MIRT507014	hsa-miR-493-5p	PAR-CLIP	23446348
MIRT756117	hsa-miR-490-3p	U2OS	26341146
MIRT066509	hsa-miR-33b-5p	Luciferase reporter assay	26830228
MIRT066509	hsa-miR-33b-5p	Luciferase reporter assay	26830228
MIRT066509	hsa-miR-33b-5p	Luciferase reporter assay	26830228
MIRT066509	hsa-miR-33b-5p	Luciferase reporter assay	26830228
MIRT002323	hsa-let-7a-5p	Immunohistochemistry, qRT-PCR	26428358
MIRT024977	hsa-miR-204-5p	Luciferase reporter assay	27095441
MIRT024977	hsa-miR-204-5p	Luciferase reporter assay	27095441
MIRT557277	hsa-miR-543	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26968810
MIRT557277	hsa-miR-543	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26968810
MIRT002082	hsa-let-7b-5p	Microarray, qRT-PCR	25600877
MIRT000109	hsa-miR-26a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26492332
MIRT000109	hsa-miR-26a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26492332
MIRT000109	hsa-miR-26a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26492332
MIRT000109	hsa-miR-26a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26492332
MIRT000109	hsa-miR-26a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26492332
MIRT000109	hsa-miR-26a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26492332
MIRT066509	hsa-miR-33b-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	28436711
MIRT066509	hsa-miR-33b-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	28436711
MIRT024977	hsa-miR-204-5p	Luciferase reporter assay, qRT-PCR, Western blot	26406941
MIRT024977	hsa-miR-204-5p	Luciferase reporter assay, qRT-PCR, Western blot	26406941
MIRT066509	hsa-miR-33b-5p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	25868853
MIRT002323	hsa-let-7a-5p	Luciferase reporter assay, qRT-PCR, Western blot	25884389
MIRT507016	hsa-let-7a-2-3p	PAR-CLIP	26701625
MIRT507016	hsa-let-7a-2-3p	PAR-CLIP	26701625
MIRT507016	hsa-let-7a-2-3p	PAR-CLIP	26701625
MIRT507016	hsa-let-7a-2-3p	PAR-CLIP	26701625
MIRT002323	hsa-let-7a-5p	PAR-CLIP	26701625
MIRT002323	hsa-let-7a-5p	PAR-CLIP	26701625
MIRT002323	hsa-let-7a-5p	PAR-CLIP	26701625
MIRT002082	hsa-let-7b-5p	PAR-CLIP	26701625
MIRT002082	hsa-let-7b-5p	PAR-CLIP	26701625
MIRT002082	hsa-let-7b-5p	PAR-CLIP	26701625
MIRT066526	hsa-let-7c-3p	PAR-CLIP	26701625
MIRT066526	hsa-let-7c-3p	PAR-CLIP	26701625
MIRT066526	hsa-let-7c-3p	PAR-CLIP	26701625
MIRT066526	hsa-let-7c-3p	PAR-CLIP	26701625
MIRT002322	hsa-let-7c-5p	PAR-CLIP	26701625
MIRT002322	hsa-let-7c-5p	PAR-CLIP	26701625
MIRT002322	hsa-let-7c-5p	PAR-CLIP	26701625
MIRT002005	hsa-let-7d-5p	PAR-CLIP	26701625
MIRT002005	hsa-let-7d-5p	PAR-CLIP	26701625
MIRT002005	hsa-let-7d-5p	PAR-CLIP	26701625
MIRT002081	hsa-let-7e-5p	PAR-CLIP	26701625
MIRT002081	hsa-let-7e-5p	PAR-CLIP	26701625
MIRT002081	hsa-let-7e-5p	PAR-CLIP	26701625
MIRT051403	hsa-let-7f-5p	PAR-CLIP	26701625
MIRT051403	hsa-let-7f-5p	PAR-CLIP	26701625
MIRT051403	hsa-let-7f-5p	PAR-CLIP	26701625
MIRT507015	hsa-let-7g-3p	PAR-CLIP	26701625
MIRT507015	hsa-let-7g-3p	PAR-CLIP	26701625
MIRT507015	hsa-let-7g-3p	PAR-CLIP	26701625
MIRT507015	hsa-let-7g-3p	PAR-CLIP	26701625
MIRT002097	hsa-let-7g-5p	PAR-CLIP	26701625
MIRT002097	hsa-let-7g-5p	PAR-CLIP	26701625
MIRT002097	hsa-let-7g-5p	PAR-CLIP	26701625
MIRT066476	hsa-let-7i-5p	PAR-CLIP	26701625
MIRT066476	hsa-let-7i-5p	PAR-CLIP	26701625
MIRT066476	hsa-let-7i-5p	PAR-CLIP	26701625
MIRT507021	hsa-miR-1244	PAR-CLIP	26701625
MIRT507021	hsa-miR-1244	PAR-CLIP	26701625
MIRT507021	hsa-miR-1244	PAR-CLIP	26701625
MIRT507021	hsa-miR-1244	PAR-CLIP	26701625
MIRT507021	hsa-miR-1244	PAR-CLIP	26701625
MIRT507021	hsa-miR-1244	PAR-CLIP	26701625
MIRT066482	hsa-miR-1296-3p	PAR-CLIP	26701625
MIRT066482	hsa-miR-1296-3p	PAR-CLIP	26701625
MIRT066482	hsa-miR-1296-3p	PAR-CLIP	26701625
MIRT066482	hsa-miR-1296-3p	PAR-CLIP	26701625
MIRT066482	hsa-miR-1296-3p	PAR-CLIP	26701625
MIRT066518	hsa-miR-142-3p	PAR-CLIP	26701625
MIRT066518	hsa-miR-142-3p	PAR-CLIP	26701625
MIRT066518	hsa-miR-142-3p	PAR-CLIP	26701625
MIRT066518	hsa-miR-142-3p	PAR-CLIP	26701625
MIRT066518	hsa-miR-142-3p	PAR-CLIP	26701625
MIRT066518	hsa-miR-142-3p	PAR-CLIP	26701625
MIRT557276	hsa-miR-181a-5p	PAR-CLIP	26701625
MIRT557276	hsa-miR-181a-5p	PAR-CLIP	26701625
MIRT557276	hsa-miR-181a-5p	PAR-CLIP	26701625
MIRT557276	hsa-miR-181a-5p	PAR-CLIP	26701625
MIRT557276	hsa-miR-181a-5p	PAR-CLIP	26701625
MIRT557275	hsa-miR-181b-5p	PAR-CLIP	26701625
MIRT557275	hsa-miR-181b-5p	PAR-CLIP	26701625
MIRT557275	hsa-miR-181b-5p	PAR-CLIP	26701625
MIRT557275	hsa-miR-181b-5p	PAR-CLIP	26701625
MIRT557275	hsa-miR-181b-5p	PAR-CLIP	26701625
MIRT557274	hsa-miR-181c-5p	PAR-CLIP	26701625
MIRT557274	hsa-miR-181c-5p	PAR-CLIP	26701625
MIRT557274	hsa-miR-181c-5p	PAR-CLIP	26701625
MIRT557274	hsa-miR-181c-5p	PAR-CLIP	26701625
MIRT557274	hsa-miR-181c-5p	PAR-CLIP	26701625
MIRT557273	hsa-miR-181d-5p	PAR-CLIP	26701625
MIRT557273	hsa-miR-181d-5p	PAR-CLIP	26701625
MIRT557273	hsa-miR-181d-5p	PAR-CLIP	26701625
MIRT557273	hsa-miR-181d-5p	PAR-CLIP	26701625
MIRT557273	hsa-miR-181d-5p	PAR-CLIP	26701625
MIRT006803	hsa-miR-196a-5p	PAR-CLIP	26701625
MIRT006803	hsa-miR-196a-5p	PAR-CLIP	26701625
MIRT006803	hsa-miR-196a-5p	PAR-CLIP	26701625
MIRT006803	hsa-miR-196a-5p	PAR-CLIP	26701625
MIRT006803	hsa-miR-196a-5p	PAR-CLIP	26701625
MIRT006803	hsa-miR-196a-5p	PAR-CLIP	26701625
MIRT066479	hsa-miR-196b-5p	PAR-CLIP	26701625
MIRT066479	hsa-miR-196b-5p	PAR-CLIP	26701625
MIRT066479	hsa-miR-196b-5p	PAR-CLIP	26701625
MIRT066479	hsa-miR-196b-5p	PAR-CLIP	26701625
MIRT066479	hsa-miR-196b-5p	PAR-CLIP	26701625
MIRT066479	hsa-miR-196b-5p	PAR-CLIP	26701625
MIRT507019	hsa-miR-19a-5p	PAR-CLIP	26701625
MIRT507019	hsa-miR-19a-5p	PAR-CLIP	26701625
MIRT507019	hsa-miR-19a-5p	PAR-CLIP	26701625
MIRT507019	hsa-miR-19a-5p	PAR-CLIP	26701625
MIRT507018	hsa-miR-19b-1-5p	PAR-CLIP	26701625
MIRT507018	hsa-miR-19b-1-5p	PAR-CLIP	26701625
MIRT507018	hsa-miR-19b-1-5p	PAR-CLIP	26701625
MIRT507018	hsa-miR-19b-1-5p	PAR-CLIP	26701625
MIRT507017	hsa-miR-19b-2-5p	PAR-CLIP	26701625
MIRT507017	hsa-miR-19b-2-5p	PAR-CLIP	26701625
MIRT507017	hsa-miR-19b-2-5p	PAR-CLIP	26701625
MIRT507017	hsa-miR-19b-2-5p	PAR-CLIP	26701625
MIRT066529	hsa-miR-2052	PAR-CLIP	26701625
MIRT066529	hsa-miR-2052	PAR-CLIP	26701625
MIRT066529	hsa-miR-2052	PAR-CLIP	26701625
MIRT066529	hsa-miR-2052	PAR-CLIP	26701625
MIRT507022	hsa-miR-219a-5p	PAR-CLIP	26701625
MIRT507022	hsa-miR-219a-5p	PAR-CLIP	26701625
MIRT507022	hsa-miR-219a-5p	PAR-CLIP	26701625
MIRT507022	hsa-miR-219a-5p	PAR-CLIP	26701625
MIRT066473	hsa-miR-25-3p	PAR-CLIP	26701625
MIRT066473	hsa-miR-25-3p	PAR-CLIP	26701625
MIRT066473	hsa-miR-25-3p	PAR-CLIP	26701625
MIRT066473	hsa-miR-25-3p	PAR-CLIP	26701625
MIRT066473	hsa-miR-25-3p	PAR-CLIP	26701625
MIRT557270	hsa-miR-3143	PAR-CLIP	26701625
MIRT557270	hsa-miR-3143	PAR-CLIP	26701625
MIRT066442	hsa-miR-3199	PAR-CLIP	26701625
MIRT066442	hsa-miR-3199	PAR-CLIP	26701625
MIRT066442	hsa-miR-3199	PAR-CLIP	26701625
MIRT066442	hsa-miR-3199	PAR-CLIP	26701625
MIRT066442	hsa-miR-3199	PAR-CLIP	26701625
MIRT066474	hsa-miR-32-5p	PAR-CLIP	26701625
MIRT066474	hsa-miR-32-5p	PAR-CLIP	26701625
MIRT066474	hsa-miR-32-5p	PAR-CLIP	26701625
MIRT066474	hsa-miR-32-5p	PAR-CLIP	26701625
MIRT066474	hsa-miR-32-5p	PAR-CLIP	26701625
MIRT066530	hsa-miR-3529-3p	PAR-CLIP	26701625
MIRT066530	hsa-miR-3529-3p	PAR-CLIP	26701625
MIRT066530	hsa-miR-3529-3p	PAR-CLIP	26701625
MIRT066530	hsa-miR-3529-3p	PAR-CLIP	26701625
MIRT066477	hsa-miR-363-3p	PAR-CLIP	26701625
MIRT066477	hsa-miR-363-3p	PAR-CLIP	26701625
MIRT066477	hsa-miR-363-3p	PAR-CLIP	26701625
MIRT066477	hsa-miR-363-3p	PAR-CLIP	26701625
MIRT066477	hsa-miR-363-3p	PAR-CLIP	26701625
MIRT274478	hsa-miR-365a-5p	PAR-CLIP	26701625
MIRT274478	hsa-miR-365a-5p	PAR-CLIP	26701625
MIRT274478	hsa-miR-365a-5p	PAR-CLIP	26701625
MIRT274478	hsa-miR-365a-5p	PAR-CLIP	26701625
MIRT274478	hsa-miR-365a-5p	PAR-CLIP	26701625
MIRT274478	hsa-miR-365a-5p	PAR-CLIP	26701625
MIRT274479	hsa-miR-365b-5p	PAR-CLIP	26701625
MIRT274479	hsa-miR-365b-5p	PAR-CLIP	26701625
MIRT274479	hsa-miR-365b-5p	PAR-CLIP	26701625
MIRT274479	hsa-miR-365b-5p	PAR-CLIP	26701625
MIRT274479	hsa-miR-365b-5p	PAR-CLIP	26701625
MIRT274479	hsa-miR-365b-5p	PAR-CLIP	26701625
MIRT066478	hsa-miR-367-3p	PAR-CLIP	26701625
MIRT066478	hsa-miR-367-3p	PAR-CLIP	26701625
MIRT066478	hsa-miR-367-3p	PAR-CLIP	26701625
MIRT066478	hsa-miR-367-3p	PAR-CLIP	26701625
MIRT066478	hsa-miR-367-3p	PAR-CLIP	26701625
MIRT066485	hsa-miR-4257	PAR-CLIP	26701625
MIRT066485	hsa-miR-4257	PAR-CLIP	26701625
MIRT066485	hsa-miR-4257	PAR-CLIP	26701625
MIRT066485	hsa-miR-4257	PAR-CLIP	26701625
MIRT066485	hsa-miR-4257	PAR-CLIP	26701625
MIRT557272	hsa-miR-4262	PAR-CLIP	26701625
MIRT557272	hsa-miR-4262	PAR-CLIP	26701625
MIRT557272	hsa-miR-4262	PAR-CLIP	26701625
MIRT557272	hsa-miR-4262	PAR-CLIP	26701625
MIRT557272	hsa-miR-4262	PAR-CLIP	26701625
MIRT507020	hsa-miR-4445-5p	PAR-CLIP	26701625
MIRT507020	hsa-miR-4445-5p	PAR-CLIP	26701625
MIRT507020	hsa-miR-4445-5p	PAR-CLIP	26701625
MIRT507020	hsa-miR-4445-5p	PAR-CLIP	26701625
MIRT557271	hsa-miR-4450	PAR-CLIP	26701625
MIRT557271	hsa-miR-4450	PAR-CLIP	26701625
MIRT557271	hsa-miR-4450	PAR-CLIP	26701625
MIRT557271	hsa-miR-4450	PAR-CLIP	26701625
MIRT557271	hsa-miR-4450	PAR-CLIP	26701625
MIRT066487	hsa-miR-4458	PAR-CLIP	26701625
MIRT066487	hsa-miR-4458	PAR-CLIP	26701625
MIRT066487	hsa-miR-4458	PAR-CLIP	26701625
MIRT066488	hsa-miR-4461	PAR-CLIP	26701625
MIRT066488	hsa-miR-4461	PAR-CLIP	26701625
MIRT066488	hsa-miR-4461	PAR-CLIP	26701625
MIRT066488	hsa-miR-4461	PAR-CLIP	26701625
MIRT066488	hsa-miR-4461	PAR-CLIP	26701625
MIRT066489	hsa-miR-4500	PAR-CLIP	26701625
MIRT066489	hsa-miR-4500	PAR-CLIP	26701625
MIRT066489	hsa-miR-4500	PAR-CLIP	26701625
MIRT066490	hsa-miR-4727-3p	PAR-CLIP	26701625
MIRT066490	hsa-miR-4727-3p	PAR-CLIP	26701625
MIRT066490	hsa-miR-4727-3p	PAR-CLIP	26701625
MIRT066490	hsa-miR-4727-3p	PAR-CLIP	26701625
MIRT066490	hsa-miR-4727-3p	PAR-CLIP	26701625
MIRT507023	hsa-miR-4782-3p	PAR-CLIP	26701625
MIRT507023	hsa-miR-4782-3p	PAR-CLIP	26701625
MIRT507023	hsa-miR-4782-3p	PAR-CLIP	26701625
MIRT507023	hsa-miR-4782-3p	PAR-CLIP	26701625
MIRT066480	hsa-miR-491-5p	PAR-CLIP	26701625
MIRT066480	hsa-miR-491-5p	PAR-CLIP	26701625
MIRT066480	hsa-miR-491-5p	PAR-CLIP	26701625
MIRT066480	hsa-miR-491-5p	PAR-CLIP	26701625
MIRT066480	hsa-miR-491-5p	PAR-CLIP	26701625
MIRT507014	hsa-miR-493-5p	PAR-CLIP	26701625
MIRT507014	hsa-miR-493-5p	PAR-CLIP	26701625
MIRT507014	hsa-miR-493-5p	PAR-CLIP	26701625
MIRT507014	hsa-miR-493-5p	PAR-CLIP	26701625
MIRT066527	hsa-miR-508-3p	PAR-CLIP	26701625
MIRT066527	hsa-miR-508-3p	PAR-CLIP	26701625
MIRT066527	hsa-miR-508-3p	PAR-CLIP	26701625
MIRT066527	hsa-miR-508-3p	PAR-CLIP	26701625
MIRT557277	hsa-miR-543	PAR-CLIP	26701625
MIRT557277	hsa-miR-543	PAR-CLIP	26701625
MIRT557277	hsa-miR-543	PAR-CLIP	26701625
MIRT557277	hsa-miR-543	PAR-CLIP	26701625
MIRT557277	hsa-miR-543	PAR-CLIP	26701625
MIRT066528	hsa-miR-648	PAR-CLIP	26701625
MIRT066528	hsa-miR-648	PAR-CLIP	26701625
MIRT066528	hsa-miR-648	PAR-CLIP	26701625
MIRT066528	hsa-miR-648	PAR-CLIP	26701625
MIRT066528	hsa-miR-648	PAR-CLIP	26701625
MIRT066528	hsa-miR-648	PAR-CLIP	26701625
MIRT507024	hsa-miR-6766-3p	PAR-CLIP	26701625
MIRT507024	hsa-miR-6766-3p	PAR-CLIP	26701625
MIRT507024	hsa-miR-6766-3p	PAR-CLIP	26701625
MIRT507024	hsa-miR-6766-3p	PAR-CLIP	26701625
MIRT066496	hsa-miR-6847-5p	PAR-CLIP	26701625
MIRT066496	hsa-miR-6847-5p	PAR-CLIP	26701625
MIRT066496	hsa-miR-6847-5p	PAR-CLIP	26701625
MIRT066496	hsa-miR-6847-5p	PAR-CLIP	26701625
MIRT066496	hsa-miR-6847-5p	PAR-CLIP	26701625
MIRT066497	hsa-miR-6857-5p	PAR-CLIP	26701625
MIRT066497	hsa-miR-6857-5p	PAR-CLIP	26701625
MIRT066497	hsa-miR-6857-5p	PAR-CLIP	26701625
MIRT066497	hsa-miR-6857-5p	PAR-CLIP	26701625
MIRT066497	hsa-miR-6857-5p	PAR-CLIP	26701625
MIRT066498	hsa-miR-6869-5p	PAR-CLIP	26701625
MIRT066498	hsa-miR-6869-5p	PAR-CLIP	26701625
MIRT066498	hsa-miR-6869-5p	PAR-CLIP	26701625
MIRT066498	hsa-miR-6869-5p	PAR-CLIP	26701625
MIRT066498	hsa-miR-6869-5p	PAR-CLIP	26701625
MIRT066450	hsa-miR-8052	PAR-CLIP	26701625
MIRT066450	hsa-miR-8052	PAR-CLIP	26701625
MIRT066450	hsa-miR-8052	PAR-CLIP	26701625
MIRT066450	hsa-miR-8052	PAR-CLIP	26701625
MIRT066450	hsa-miR-8052	PAR-CLIP	26701625
MIRT066475	hsa-miR-92a-3p	PAR-CLIP	26701625
MIRT066475	hsa-miR-92a-3p	PAR-CLIP	26701625
MIRT066475	hsa-miR-92a-3p	PAR-CLIP	26701625
MIRT066475	hsa-miR-92a-3p	PAR-CLIP	26701625
MIRT066475	hsa-miR-92a-3p	PAR-CLIP	26701625
MIRT066481	hsa-miR-92b-3p	PAR-CLIP	26701625
MIRT066481	hsa-miR-92b-3p	PAR-CLIP	26701625
MIRT066481	hsa-miR-92b-3p	PAR-CLIP	26701625
MIRT066481	hsa-miR-92b-3p	PAR-CLIP	26701625
MIRT066481	hsa-miR-92b-3p	PAR-CLIP	26701625
MIRT002999	hsa-miR-98-5p	PAR-CLIP	26701625
MIRT002999	hsa-miR-98-5p	PAR-CLIP	26701625
MIRT002999	hsa-miR-98-5p	PAR-CLIP	26701625
MIRT734199	hsa-miR-376b-3p	Flow cytometry, Immunofluorescence, Immunohistochemistry (IHC), Microarray, qRT-PCR, Western blotting	31899875
MIRT734199	hsa-miR-376b-3p	Immunofluorescence, Immunohistochemistry (IHC), Luciferase reporter assay, qRT-PCR, Western blotting	31899875
MIRT735142	hsa-miR-1910-5p	Microarray, qRT-PCR, Flow cytometry	32661467
MIRT735276	hsa-let-7a-3p	Northern blotting, RNA-seq, qRT-PCR, In situ hybridization	32432989
MIRT735324	hsa-miR-149-3p	Luciferase reporter assay, Western blotting, qRT-PCR	33257506
MIRT024977	hsa-miR-204-5p	Luciferase reporter assay	31513636
MIRT002323	hsa-let-7a-5p	qRT-PCR	33550286
MIRT736168	hsa-miR-148b-3p	RNA-seq, qRT-PCR	31796837
MIRT736212	hsa-miR-578	Luciferase reporter assay, Western blotting, qRT-PCR	34236145
MIRT002999	hsa-miR-98-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry	31670857
MIRT737351	hsa-miR-143-5p	Western blotting, Immunohistochemistry (IHC)	32623445
MIRT002082	hsa-let-7b-5p	HITS-CLIP	21572407
MIRT002322	hsa-let-7c-5p	HITS-CLIP	21572407
MIRT002005	hsa-let-7d-5p	HITS-CLIP	21572407
MIRT002081	hsa-let-7e-5p	HITS-CLIP	21572407
MIRT051403	hsa-let-7f-5p	HITS-CLIP	21572407
MIRT002097	hsa-let-7g-5p	HITS-CLIP	21572407
MIRT066476	hsa-let-7i-5p	HITS-CLIP	21572407
MIRT066487	hsa-miR-4458	HITS-CLIP	21572407
MIRT002323	hsa-let-7a-5p	HITS-CLIP	21572407
MIRT066489	hsa-miR-4500	HITS-CLIP	21572407
MIRT002999	hsa-miR-98-5p	HITS-CLIP	21572407
MIRT066479	hsa-miR-196b-5p	HITS-CLIP	21572407
MIRT006803	hsa-miR-196a-5p	HITS-CLIP	21572407
MIRT507024	hsa-miR-6766-3p	HITS-CLIP	21572407
MIRT507023	hsa-miR-4782-3p	HITS-CLIP	21572407
MIRT507022	hsa-miR-219a-5p	HITS-CLIP	21572407
MIRT066518	hsa-miR-142-3p	HITS-CLIP	21572407
MIRT066530	hsa-miR-3529-3p	HITS-CLIP	21572407
MIRT507021	hsa-miR-1244	HITS-CLIP	21572407
MIRT066528	hsa-miR-648	HITS-CLIP	21572407
MIRT066527	hsa-miR-508-3p	HITS-CLIP	21572407
MIRT507020	hsa-miR-4445-5p	HITS-CLIP	21572407
MIRT066442	hsa-miR-3199	HITS-CLIP	21572407
MIRT066450	hsa-miR-8052	HITS-CLIP	21572407
MIRT274478	hsa-miR-365a-5p	HITS-CLIP	21572407
MIRT274479	hsa-miR-365b-5p	HITS-CLIP	21572407
MIRT066529	hsa-miR-2052	HITS-CLIP	21572407
MIRT507019	hsa-miR-19a-5p	HITS-CLIP	21572407
MIRT507018	hsa-miR-19b-1-5p	HITS-CLIP	21572407
MIRT507017	hsa-miR-19b-2-5p	HITS-CLIP	21572407
MIRT066526	hsa-let-7c-3p	HITS-CLIP	21572407
MIRT507016	hsa-let-7a-2-3p	HITS-CLIP	21572407
MIRT507015	hsa-let-7g-3p	HITS-CLIP	21572407
MIRT507014	hsa-miR-493-5p	HITS-CLIP	21572407
MIRT507024	hsa-miR-6766-3p	PAR-CLIP	20371350
MIRT507023	hsa-miR-4782-3p	PAR-CLIP	20371350
MIRT507022	hsa-miR-219a-5p	PAR-CLIP	20371350
MIRT006803	hsa-miR-196a-5p	PAR-CLIP	20371350
MIRT066479	hsa-miR-196b-5p	PAR-CLIP	20371350
MIRT002097	hsa-let-7g-5p	PAR-CLIP	20371350
MIRT051403	hsa-let-7f-5p	PAR-CLIP	20371350
MIRT002005	hsa-let-7d-5p	PAR-CLIP	20371350
MIRT066489	hsa-miR-4500	PAR-CLIP	20371350
MIRT066476	hsa-let-7i-5p	PAR-CLIP	20371350
MIRT066487	hsa-miR-4458	PAR-CLIP	20371350
MIRT002081	hsa-let-7e-5p	PAR-CLIP	20371350
MIRT002999	hsa-miR-98-5p	PAR-CLIP	20371350
MIRT002323	hsa-let-7a-5p	PAR-CLIP	20371350
MIRT002322	hsa-let-7c-5p	PAR-CLIP	20371350
MIRT002082	hsa-let-7b-5p	PAR-CLIP	20371350
MIRT066530	hsa-miR-3529-3p	PAR-CLIP	20371350
MIRT507021	hsa-miR-1244	PAR-CLIP	20371350
MIRT066528	hsa-miR-648	PAR-CLIP	20371350
MIRT066527	hsa-miR-508-3p	PAR-CLIP	20371350
MIRT507020	hsa-miR-4445-5p	PAR-CLIP	20371350
MIRT066442	hsa-miR-3199	PAR-CLIP	20371350
MIRT066450	hsa-miR-8052	PAR-CLIP	20371350
MIRT274478	hsa-miR-365a-5p	PAR-CLIP	20371350
MIRT274479	hsa-miR-365b-5p	PAR-CLIP	20371350
MIRT066518	hsa-miR-142-3p	PAR-CLIP	20371350
MIRT066529	hsa-miR-2052	PAR-CLIP	20371350
MIRT507019	hsa-miR-19a-5p	PAR-CLIP	20371350
MIRT507018	hsa-miR-19b-1-5p	PAR-CLIP	20371350
MIRT507017	hsa-miR-19b-2-5p	PAR-CLIP	20371350
MIRT066526	hsa-let-7c-3p	PAR-CLIP	20371350
MIRT507016	hsa-let-7a-2-3p	PAR-CLIP	20371350
MIRT507015	hsa-let-7g-3p	PAR-CLIP	20371350
MIRT507014	hsa-miR-493-5p	PAR-CLIP	20371350
MIRT066474	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT066473	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT066481	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT066475	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT066477	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT066478	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT557277	hsa-miR-543	PAR-CLIP	21572407
MIRT557276	hsa-miR-181a-5p	PAR-CLIP	21572407
MIRT557275	hsa-miR-181b-5p	PAR-CLIP	21572407
MIRT557274	hsa-miR-181c-5p	PAR-CLIP	21572407
MIRT557273	hsa-miR-181d-5p	PAR-CLIP	21572407
MIRT557272	hsa-miR-4262	PAR-CLIP	21572407
MIRT066482	hsa-miR-1296-3p	PAR-CLIP	21572407
MIRT066488	hsa-miR-4461	PAR-CLIP	21572407
MIRT066496	hsa-miR-6847-5p	PAR-CLIP	21572407
MIRT066485	hsa-miR-4257	PAR-CLIP	21572407
MIRT557271	hsa-miR-4450	PAR-CLIP	21572407
MIRT066480	hsa-miR-491-5p	PAR-CLIP	21572407
MIRT557270	hsa-miR-3143	PAR-CLIP	21572407
MIRT066490	hsa-miR-4727-3p	PAR-CLIP	21572407
MIRT066498	hsa-miR-6869-5p	PAR-CLIP	21572407
MIRT066497	hsa-miR-6857-5p	PAR-CLIP	21572407
MIRT066479	hsa-miR-196b-5p	PAR-CLIP	23446348
MIRT006803	hsa-miR-196a-5p	PAR-CLIP	23446348
MIRT507024	hsa-miR-6766-3p	PAR-CLIP	23446348
MIRT507023	hsa-miR-4782-3p	PAR-CLIP	23446348
MIRT507022	hsa-miR-219a-5p	PAR-CLIP	23446348
MIRT066518	hsa-miR-142-3p	PAR-CLIP	23446348
MIRT066530	hsa-miR-3529-3p	PAR-CLIP	23446348
MIRT507021	hsa-miR-1244	PAR-CLIP	23446348
MIRT066528	hsa-miR-648	PAR-CLIP	23446348
MIRT066527	hsa-miR-508-3p	PAR-CLIP	23446348
MIRT507020	hsa-miR-4445-5p	PAR-CLIP	23446348
MIRT066442	hsa-miR-3199	PAR-CLIP	23446348
MIRT066450	hsa-miR-8052	PAR-CLIP	23446348
MIRT274478	hsa-miR-365a-5p	PAR-CLIP	23446348
MIRT274479	hsa-miR-365b-5p	PAR-CLIP	23446348
MIRT066529	hsa-miR-2052	PAR-CLIP	23446348
MIRT507019	hsa-miR-19a-5p	PAR-CLIP	23446348
MIRT507018	hsa-miR-19b-1-5p	PAR-CLIP	23446348
MIRT507017	hsa-miR-19b-2-5p	PAR-CLIP	23446348
MIRT066526	hsa-let-7c-3p	PAR-CLIP	23446348
MIRT507016	hsa-let-7a-2-3p	PAR-CLIP	23446348
MIRT507015	hsa-let-7g-3p	PAR-CLIP	23446348
MIRT507014	hsa-miR-493-5p	PAR-CLIP	23446348
MIRT066479	hsa-miR-196b-5p	PAR-CLIP	23446348
MIRT006803	hsa-miR-196a-5p	PAR-CLIP	23446348
MIRT507024	hsa-miR-6766-3p	PAR-CLIP	23446348
MIRT507023	hsa-miR-4782-3p	PAR-CLIP	23446348
MIRT507022	hsa-miR-219a-5p	PAR-CLIP	23446348
MIRT066530	hsa-miR-3529-3p	PAR-CLIP	23446348
MIRT507021	hsa-miR-1244	PAR-CLIP	23446348
MIRT066528	hsa-miR-648	PAR-CLIP	23446348
MIRT066527	hsa-miR-508-3p	PAR-CLIP	23446348
MIRT507020	hsa-miR-4445-5p	PAR-CLIP	23446348
MIRT274478	hsa-miR-365a-5p	PAR-CLIP	23446348
MIRT274479	hsa-miR-365b-5p	PAR-CLIP	23446348
MIRT066518	hsa-miR-142-3p	PAR-CLIP	23446348
MIRT066529	hsa-miR-2052	PAR-CLIP	23446348
MIRT507019	hsa-miR-19a-5p	PAR-CLIP	23446348
MIRT507018	hsa-miR-19b-1-5p	PAR-CLIP	23446348
MIRT507017	hsa-miR-19b-2-5p	PAR-CLIP	23446348
MIRT066526	hsa-let-7c-3p	PAR-CLIP	23446348
MIRT507016	hsa-let-7a-2-3p	PAR-CLIP	23446348
MIRT507015	hsa-let-7g-3p	PAR-CLIP	23446348
MIRT507014	hsa-miR-493-5p	PAR-CLIP	23446348
MIRT024977	hsa-miR-204-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunoprecipitaion (IP), In situ hybridization	35428261
MIRT755354	hsa-miR-103a-3p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunohistochemistry (IHC)	35466471
MIRT755808	miRNA-143-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunoprecipitaion (IP), In situ hybridization	37529164
MIRT755967	hsa-miR-206	Luciferase reporter assay, Western blotting, qRT-PCR, Immunoprecipitaion (IP), In situ hybridization	38112616
MIRT1049140	hsa-miR-1208	CLIP-seq
MIRT1049141	hsa-miR-1298	CLIP-seq
MIRT1049142	hsa-miR-3616-5p	CLIP-seq
MIRT1049143	hsa-miR-3647-5p	CLIP-seq
MIRT1049144	hsa-miR-4252	CLIP-seq
MIRT1049145	hsa-miR-4282	CLIP-seq
MIRT1049146	hsa-miR-452	CLIP-seq
MIRT1049147	hsa-miR-4676-3p	CLIP-seq
MIRT1049148	hsa-miR-516b	CLIP-seq
MIRT1049149	hsa-miR-548c-3p	CLIP-seq
MIRT1049150	hsa-miR-556-5p	CLIP-seq
MIRT1049151	hsa-miR-573	CLIP-seq
MIRT1549538	hsa-let-7a	CLIP-seq
MIRT1549539	hsa-let-7b	CLIP-seq
MIRT1549540	hsa-let-7c	CLIP-seq
MIRT1549541	hsa-let-7d	CLIP-seq
MIRT1549542	hsa-let-7e	CLIP-seq
MIRT1549543	hsa-let-7f	CLIP-seq
MIRT1549544	hsa-let-7g	CLIP-seq
MIRT1549545	hsa-let-7i	CLIP-seq
MIRT1549546	hsa-miR-1224-5p	CLIP-seq
MIRT1549547	hsa-miR-1304	CLIP-seq
MIRT1549548	hsa-miR-202	CLIP-seq
MIRT1549549	hsa-miR-28-5p	CLIP-seq
MIRT1549550	hsa-miR-3139	CLIP-seq
MIRT1549551	hsa-miR-362-5p	CLIP-seq
MIRT1549552	hsa-miR-3647-3p	CLIP-seq
MIRT1549553	hsa-miR-3653	CLIP-seq
MIRT1549554	hsa-miR-3658	CLIP-seq
MIRT1549555	hsa-miR-3915	CLIP-seq
MIRT1549556	hsa-miR-3928	CLIP-seq
MIRT1549557	hsa-miR-4511	CLIP-seq
MIRT1549558	hsa-miR-4689	CLIP-seq
MIRT1549559	hsa-miR-500b	CLIP-seq
MIRT1549560	hsa-miR-501-5p	CLIP-seq
MIRT1549561	hsa-miR-548b-3p	CLIP-seq
MIRT1549562	hsa-miR-548s	CLIP-seq
MIRT1549563	hsa-miR-708	CLIP-seq
MIRT1549564	hsa-miR-98	CLIP-seq
MIRT1549538	hsa-let-7a	CLIP-seq
MIRT1549539	hsa-let-7b	CLIP-seq
MIRT1549540	hsa-let-7c	CLIP-seq
MIRT1549541	hsa-let-7d	CLIP-seq
MIRT1549542	hsa-let-7e	CLIP-seq
MIRT1549543	hsa-let-7f	CLIP-seq
MIRT1549544	hsa-let-7g	CLIP-seq
MIRT1549545	hsa-let-7i	CLIP-seq
MIRT2011247	hsa-miR-1207-3p	CLIP-seq
MIRT2011248	hsa-miR-125a-5p	CLIP-seq
MIRT2011249	hsa-miR-125b	CLIP-seq
MIRT2011250	hsa-miR-302f	CLIP-seq
MIRT2011251	hsa-miR-3187-3p	CLIP-seq
MIRT2011252	hsa-miR-4287	CLIP-seq
MIRT2011253	hsa-miR-4319	CLIP-seq
MIRT2011254	hsa-miR-4435	CLIP-seq
MIRT2011255	hsa-miR-4469	CLIP-seq
MIRT2011256	hsa-miR-4685-3p	CLIP-seq
MIRT2011257	hsa-miR-4701-5p	CLIP-seq
MIRT2011258	hsa-miR-4711-3p	CLIP-seq
MIRT2011259	hsa-miR-4713-5p	CLIP-seq
MIRT2011260	hsa-miR-4732-3p	CLIP-seq
MIRT2011261	hsa-miR-4773	CLIP-seq
MIRT1549562	hsa-miR-548s	CLIP-seq
MIRT1049150	hsa-miR-556-5p	CLIP-seq
MIRT2011262	hsa-miR-588	CLIP-seq
MIRT2011263	hsa-miR-646	CLIP-seq
MIRT2011264	hsa-miR-670	CLIP-seq
MIRT2011265	hsa-miR-7	CLIP-seq
MIRT2011266	hsa-miR-942	CLIP-seq
MIRT1549564	hsa-miR-98	CLIP-seq
MIRT1549538	hsa-let-7a	CLIP-seq
MIRT1549539	hsa-let-7b	CLIP-seq
MIRT1549540	hsa-let-7c	CLIP-seq
MIRT1549541	hsa-let-7d	CLIP-seq
MIRT1549542	hsa-let-7e	CLIP-seq
MIRT1549543	hsa-let-7f	CLIP-seq
MIRT1549544	hsa-let-7g	CLIP-seq
MIRT1549545	hsa-let-7i	CLIP-seq
MIRT2011247	hsa-miR-1207-3p	CLIP-seq
MIRT2011248	hsa-miR-125a-5p	CLIP-seq
MIRT2011249	hsa-miR-125b	CLIP-seq
MIRT2243475	hsa-miR-1273f	CLIP-seq
MIRT1549547	hsa-miR-1304	CLIP-seq
MIRT1549548	hsa-miR-202	CLIP-seq
MIRT2243476	hsa-miR-4275	CLIP-seq
MIRT1049145	hsa-miR-4282	CLIP-seq
MIRT2011253	hsa-miR-4319	CLIP-seq
MIRT2243477	hsa-miR-450b-5p	CLIP-seq
MIRT2243478	hsa-miR-4540	CLIP-seq
MIRT2011260	hsa-miR-4732-3p	CLIP-seq
MIRT2243479	hsa-miR-579	CLIP-seq
MIRT2011263	hsa-miR-646	CLIP-seq
MIRT2011264	hsa-miR-670	CLIP-seq
MIRT2011265	hsa-miR-7	CLIP-seq
MIRT1549564	hsa-miR-98	CLIP-seq
MIRT2389032	hsa-miR-1229	CLIP-seq
MIRT2389033	hsa-miR-1293	CLIP-seq
MIRT2389034	hsa-miR-3170	CLIP-seq
MIRT2389035	hsa-miR-3179	CLIP-seq
MIRT2389036	hsa-miR-33a	CLIP-seq
MIRT2389037	hsa-miR-33b	CLIP-seq
MIRT2389038	hsa-miR-342-5p	CLIP-seq
MIRT2389039	hsa-miR-3611	CLIP-seq
MIRT2389040	hsa-miR-3940-5p	CLIP-seq
MIRT2389041	hsa-miR-4270	CLIP-seq
MIRT2389042	hsa-miR-4310	CLIP-seq
MIRT2389043	hsa-miR-4328	CLIP-seq
MIRT2389044	hsa-miR-4441	CLIP-seq
MIRT2389045	hsa-miR-4481	CLIP-seq
MIRT2389046	hsa-miR-4483	CLIP-seq
MIRT2389047	hsa-miR-4507	CLIP-seq
MIRT2389048	hsa-miR-4651	CLIP-seq
MIRT2389049	hsa-miR-4664-5p	CLIP-seq
MIRT2011259	hsa-miR-4713-5p	CLIP-seq
MIRT2389050	hsa-miR-4745-5p	CLIP-seq
MIRT2011261	hsa-miR-4773	CLIP-seq
MIRT2389051	hsa-miR-499-3p	CLIP-seq
MIRT2389052	hsa-miR-499a-3p	CLIP-seq
MIRT2389053	hsa-miR-5096	CLIP-seq
MIRT2389054	hsa-miR-522	CLIP-seq
MIRT2389055	hsa-miR-548ac	CLIP-seq
MIRT2389056	hsa-miR-548ae	CLIP-seq
MIRT2389057	hsa-miR-548aj	CLIP-seq
MIRT2389058	hsa-miR-548am	CLIP-seq
MIRT2389059	hsa-miR-548d-3p	CLIP-seq
MIRT2389060	hsa-miR-548t	CLIP-seq
MIRT2389061	hsa-miR-548x	CLIP-seq
MIRT2389062	hsa-miR-548z	CLIP-seq
MIRT1049150	hsa-miR-556-5p	CLIP-seq
MIRT2389063	hsa-miR-608	CLIP-seq
MIRT2011263	hsa-miR-646	CLIP-seq
MIRT1549538	hsa-let-7a	CLIP-seq
MIRT1549539	hsa-let-7b	CLIP-seq
MIRT1549540	hsa-let-7c	CLIP-seq
MIRT1549541	hsa-let-7d	CLIP-seq
MIRT1549542	hsa-let-7e	CLIP-seq
MIRT1549543	hsa-let-7f	CLIP-seq
MIRT1549544	hsa-let-7g	CLIP-seq
MIRT1549545	hsa-let-7i	CLIP-seq
MIRT2429622	hsa-miR-103a	CLIP-seq
MIRT2429623	hsa-miR-1273e	CLIP-seq
MIRT2429624	hsa-miR-1305	CLIP-seq
MIRT2429625	hsa-miR-1324	CLIP-seq
MIRT2429626	hsa-miR-151-3p	CLIP-seq
MIRT2429627	hsa-miR-15a	CLIP-seq
MIRT2429628	hsa-miR-15b	CLIP-seq
MIRT2429629	hsa-miR-16	CLIP-seq
MIRT2429630	hsa-miR-194	CLIP-seq
MIRT2429631	hsa-miR-195	CLIP-seq
MIRT2429632	hsa-miR-196a	CLIP-seq
MIRT2429633	hsa-miR-196b	CLIP-seq
MIRT2429634	hsa-miR-1976	CLIP-seq
MIRT2429635	hsa-miR-2054	CLIP-seq
MIRT2429636	hsa-miR-28-3p	CLIP-seq
MIRT2429637	hsa-miR-298	CLIP-seq
MIRT2429638	hsa-miR-3065-5p	CLIP-seq
MIRT2429639	hsa-miR-3120-3p	CLIP-seq
MIRT2429640	hsa-miR-3123	CLIP-seq
MIRT2389036	hsa-miR-33a	CLIP-seq
MIRT2389037	hsa-miR-33b	CLIP-seq
MIRT2429641	hsa-miR-3529	CLIP-seq
MIRT2429642	hsa-miR-3607-3p	CLIP-seq
MIRT2429643	hsa-miR-3678-3p	CLIP-seq
MIRT2429644	hsa-miR-369-3p	CLIP-seq
MIRT2429645	hsa-miR-374c	CLIP-seq
MIRT2429646	hsa-miR-376a	CLIP-seq
MIRT2429647	hsa-miR-376b	CLIP-seq
MIRT2429648	hsa-miR-379	CLIP-seq
MIRT2429649	hsa-miR-380	CLIP-seq
MIRT2429650	hsa-miR-3925-5p	CLIP-seq
MIRT2429651	hsa-miR-3973	CLIP-seq
MIRT2429652	hsa-miR-421	CLIP-seq
MIRT2429653	hsa-miR-424	CLIP-seq
MIRT2429654	hsa-miR-4279	CLIP-seq
MIRT2429655	hsa-miR-4451	CLIP-seq
MIRT2429656	hsa-miR-4463	CLIP-seq
MIRT2429657	hsa-miR-4499	CLIP-seq
MIRT2429658	hsa-miR-4524	CLIP-seq
MIRT2429659	hsa-miR-4650-3p	CLIP-seq
MIRT2429660	hsa-miR-4704-5p	CLIP-seq
MIRT2429661	hsa-miR-497	CLIP-seq
MIRT2429662	hsa-miR-503	CLIP-seq
MIRT2429663	hsa-miR-520d-5p	CLIP-seq
MIRT2429664	hsa-miR-520g	CLIP-seq
MIRT2429665	hsa-miR-520h	CLIP-seq
MIRT2389054	hsa-miR-522	CLIP-seq
MIRT2429666	hsa-miR-524-5p	CLIP-seq
MIRT2429667	hsa-miR-539	CLIP-seq
MIRT2429668	hsa-miR-548k	CLIP-seq
MIRT2429669	hsa-miR-581	CLIP-seq
MIRT2011263	hsa-miR-646	CLIP-seq
MIRT2429670	hsa-miR-655	CLIP-seq
MIRT1549564	hsa-miR-98	CLIP-seq
MIRT2437625	hsa-miR-1283	CLIP-seq
MIRT2437626	hsa-miR-26a	CLIP-seq
MIRT2437627	hsa-miR-26b	CLIP-seq
MIRT2437628	hsa-miR-4465	CLIP-seq
MIRT2437629	hsa-miR-493	CLIP-seq
MIRT2429663	hsa-miR-520d-5p	CLIP-seq
MIRT2429666	hsa-miR-524-5p	CLIP-seq
MIRT2546682	hsa-miR-3136-3p	CLIP-seq
MIRT2429667	hsa-miR-539	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
BRCA1	Repression	20007691
SP1	Unknown	11802722
SP3	Unknown	11802722
ZNF350	Repression	20007691
ZNF382	Repression	20682794

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	14627817
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000228	Component	Nuclear chromosome	IEA
GO:0000228	Component	Nuclear chromosome	ISS
GO:0000785	Component	Chromatin	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	17426251
GO:0001673	Component	Male germ cell nucleus	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	IMP	18832382
GO:0002062	Process	Chondrocyte differentiation	IDA	21484705
GO:0003131	Process	Mesodermal-endodermal cell signaling	IMP	17624332
GO:0003676	Function	Nucleic acid binding	EXP	29262356
GO:0003677	Function	DNA binding	IEA
GO:0003680	Function	Minor groove of adenine-thymine-rich DNA binding	IBA
GO:0003680	Function	Minor groove of adenine-thymine-rich DNA binding	IDA	14627817, 17078040, 17426251, 20108983, 21533145
GO:0003680	Function	Minor groove of adenine-thymine-rich DNA binding	IEA
GO:0003680	Function	Minor groove of adenine-thymine-rich DNA binding	IMP	18832382
GO:0003712	Function	Transcription coregulator activity	IBA
GO:0003714	Function	Transcription corepressor activity	IDA	14627817
GO:0003906	Function	DNA-(apurinic or apyrimidinic site) endonuclease activity	IDA	19465398
GO:0005515	Function	Protein binding	IPI	16293633, 17324944, 19465398, 29391048
GO:0005634	Component	Nucleus	HDA	16791210
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	16901784, 17078040, 17324944
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006284	Process	Base-excision repair	IDA	19465398
GO:0006325	Process	Chromatin organization	TAS	19551524
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IMP	7606786
GO:0007283	Process	Spermatogenesis	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008301	Function	DNA binding, bending	IDA	20108983
GO:0008301	Function	DNA binding, bending	IMP	14627817
GO:0008584	Process	Male gonad development	IEA
GO:0009615	Process	Response to virus	IEP	17005673
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010557	Process	Positive regulation of macromolecule biosynthetic process	IEA
GO:0010564	Process	Regulation of cell cycle process	IDA	14645522
GO:0010564	Process	Regulation of cell cycle process	IEA
GO:0010628	Process	Positive regulation of gene expression	IDA	18832382
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0019899	Function	Enzyme binding	IEA
GO:0021846	Process	Cell proliferation in forebrain	IEA
GO:0021983	Process	Pituitary gland development	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IEA
GO:0030261	Process	Chromosome condensation	IEA
GO:0030325	Process	Adrenal gland development	IEA
GO:0031492	Function	Nucleosomal DNA binding	IDA	17078040
GO:0031507	Process	Heterochromatin formation	IDA	16901784
GO:0032993	Component	Protein-DNA complex	IDA	19465398
GO:0033144	Process	Negative regulation of intracellular steroid hormone receptor signaling pathway	IEA
GO:0035019	Process	Somatic stem cell population maintenance	IEA
GO:0035264	Process	Multicellular organism growth	IEA
GO:0035497	Function	CAMP response element binding	IDA	14645522
GO:0035500	Function	MH2 domain binding	IDA	18832382
GO:0035501	Function	MH1 domain binding	IDA	18832382
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035556	Process	Intracellular signal transduction	IDA	16061642
GO:0035985	Component	Senescence-associated heterochromatin focus	IDA	16901784
GO:0035987	Process	Endodermal cell differentiation	IMP	17624332
GO:0035988	Process	Chondrocyte proliferation	IDA	21484705
GO:0040018	Process	Positive regulation of multicellular organism growth	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IDA	19465398
GO:0043392	Process	Negative regulation of DNA binding	IDA	14645522
GO:0043392	Process	Negative regulation of DNA binding	IMP	19549901
GO:0043922	Process	Host-mediated suppression of viral transcription	IDA	17005673
GO:0045444	Process	Fat cell differentiation	IMP	7606786, 17624332
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0045766	Process	Positive regulation of angiogenesis	ISS
GO:0045869	Process	Negative regulation of single stranded viral RNA replication via double stranded DNA intermediate	IDA	17005673
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	18832382
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	16901784
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	15225648, 15755872, 17005673, 17324944, 17426251
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	17624332
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	14645522, 18832382
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046332	Function	SMAD binding	IPI	18832382
GO:0046426	Process	Negative regulation of receptor signaling pathway via JAK-STAT	IEA
GO:0048144	Process	Fibroblast proliferation	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IEA
GO:0048333	Process	Mesodermal cell differentiation	IMP	17624332
GO:0048708	Process	Astrocyte differentiation	IEA
GO:0048712	Process	Negative regulation of astrocyte differentiation	IEA
GO:0048762	Process	Mesenchymal cell differentiation	IMP	7606786, 17624332
GO:0048863	Process	Stem cell differentiation	IEP	17078040
GO:0051301	Process	Cell division	IEA
GO:0051575	Function	5'-deoxyribose-5-phosphate lyase activity	IDA	19465398
GO:0060123	Process	Regulation of growth hormone secretion	IEA
GO:0060428	Process	Lung epithelium development	IEA
GO:0060441	Process	Epithelial tube branching involved in lung morphogenesis	IEA
GO:0060501	Process	Positive regulation of epithelial cell proliferation involved in lung morphogenesis	IEA
GO:0060612	Process	Adipose tissue development	IEA
GO:0060613	Process	Fat pad development	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	14645522
GO:0070742	Function	C2H2 zinc finger domain binding	IMP	14645522
GO:0071141	Component	SMAD protein complex	IDA	18832382
GO:0071864	Process	Positive regulation of cell proliferation in bone marrow	IEA
GO:0071864	Process	Positive regulation of cell proliferation in bone marrow	ISS
GO:0071902	Process	Positive regulation of protein serine/threonine kinase activity	IDA	19549901
GO:0072089	Process	Stem cell proliferation	IEA
GO:0090276	Process	Regulation of peptide hormone secretion	IEA
GO:0090402	Process	Oncogene-induced cell senescence	IDA	16901784
GO:2000036	Process	Regulation of stem cell population maintenance	IMP	17624332
GO:2000036	Process	Regulation of stem cell population maintenance	TAS	19551524
GO:2000648	Process	Positive regulation of stem cell proliferation	IDA	21484705
GO:2000648	Process	Positive regulation of stem cell proliferation	IEA
GO:2000648	Process	Positive regulation of stem cell proliferation	IMP	17624332
GO:2000773	Process	Negative regulation of cellular senescence	IEA
GO:2000773	Process	Negative regulation of cellular senescence	ISS
GO:2001033	Process	Negative regulation of double-strand break repair via nonhomologous end joining	IDA	19549901

Other IDs

• MIM: 600698
• HGNC: 5009
• e!Ensembl: ENSG00000149948

Protein

• UniProt ID: P52926
• Protein name: High mobility group protein HMGI-C (High mobility group AT-hook protein 2)
• Protein function: Functions as a transcriptional regulator. Functions in cell cycle regulation through CCNA2. Plays an important role in chromosome condensation during the meiotic G2/M transition of spermatocytes. Plays a role in postnatal myogenesis, is involved
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02178	AT_hook	26 → 38	AT hook motif	Motif
  PF02178	AT_hook	46 → 58	AT hook motif	Motif
  PF02178	AT_hook	74 → 86	AT hook motif	Motif

• Sequence:

  MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSP
  SKAAQKKAEATGEKRPRGRPRKWPQQVVQKKPAQEETEETSSQESAEED

• Sequence length: 109

Pathways

KEGG:

Transcriptional misregulation in cancer
MicroRNAs in cancer

Reactome:

Formation of Senescence-Associated Heterochromatin Foci (SAHF)

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Silver-Russell syndrome 1	Pathogenic	rs1114167319, rs1114167320	RCV000491113 RCV000491565	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Silver-Russell syndrome 5	Pathogenic; Likely pathogenic	rs2120807666, rs2498929809, rs1114167319, rs1114167320, rs2498933809, rs1876803958	RCV002227000 RCV002283710 RCV001174518 RCV001174519 RCV004545971 RCV001174517	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
12Q14 MICRODELETION SYNDROME	—	Disgenet, Orphanet Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA NERVOSA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC STENOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC VALVE CALCIFICATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BENIGN EPITHELIAL TUMOR OF SALIVARY GLANDS	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEDIFFERENTIATED LIPOSARCOMA	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHOID	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HMGA2-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RUSSELL-SILVER SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SILVER-RUSSELL SYNDROME DUE TO A POINT MUTATION	—	Disgenet, Orphanet Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine leiomyoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WELL-DIFFERENTIATED LIPOSARCOMA	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
12q14 microdeletion syndrome	12q14 microdeletion syndrome	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	12851685		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	26319392, 31173171		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	17477356, 26858029		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	18843278		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of ampulla of Vater	Adenocarcinoma	BEFREE	28524160		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	28710822		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28752530, 30535487		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	BEFREE	20597139		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	16322327, 16885341, 18375116, 28152577, 30999005, 8908160, 9484777		★☆☆☆☆ Found in Text Mining only
Adult Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	16056249		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	24898358, 24935062		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	29296743		★☆☆☆☆ Found in Text Mining only
Angiolymphoid hyperplasia	Angiolymphoid Hyperplasia	BEFREE	11979097		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	23696899, 24807963, 24920070, 28524160, 28947981, 30013637, 30228296, 31396352		★☆☆☆☆ Found in Text Mining only
Aortic Diseases	Aortic Diseases	BEFREE	21692035		★☆☆☆☆ Found in Text Mining only
Apparent mineralocorticoid excess	Apparent Mineralocorticoid Excess	BEFREE	31094929		★☆☆☆☆ Found in Text Mining only
Arnold Chiari Malformation	Arnold-Chiari malformation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30739785		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	40379848	Associate	★☆☆☆☆ Found in Text Mining only
Atelosteogenesis type 2	Atelosteogenesis	Pubtator	16567472	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30739785		★☆☆☆☆ Found in Text Mining only
Atypical Teratoid Rhabdoid Tumor	Teratoid Rhabdoid Tumor	BEFREE	24423609, 25575139		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	10347561, 10519386, 10744071, 10998430, 11170289, 12021922, 14612541, 15755872, 15882911, 16322327, 17094442, 18937276, 31660895, 9169041		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	CTD_human_DG	18413806		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	20844535, 22523064	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	24571540, 26684800, 31053526, 31306103		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	17917968		★☆☆☆☆ Found in Text Mining only
Bone Neoplasms	Bone neoplasm	Pubtator	35181586	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	25575139		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	33639654	Associate	★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	27245202		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12778070, 16077985, 22322863, 23716660, 26285644, 27063096, 27245202, 28720546, 29473328, 29518471, 30049846, 30194979, 30220054, 30825204		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12778070, 25919570, 26165842, 27188536, 27245202, 30049846, 30763339, 32031335, 34356120, 35732319, 36180890, 40686703	Associate	★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	26025649		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	12778070, 20108983, 26537313, 26787895, 28423547, 29278873, 31823639, 33139812, 35502885, 37237385, 8780382	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	31684108	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	29017393	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17935122, 18375116, 21532495, 22241470, 22790015, 23686260, 23743934, 25245141, 25439740, 26818837, 27379604, 28423547, 28463429, 28651497, 29135520, 29266325, 29437290, 30220054, 31660895, 7731681		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	23743934	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28691642, 30535489, 33970549, 36102493, 38320625, 39591457, 39664573	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31823639	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	24571540, 26684800, 31053526, 31306103		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	27874955, 29266325		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17437991, 17477356, 24305048, 25340791, 28752530, 29079814, 29883241, 30317663, 30556876, 30569167, 31692094		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	25749380, 26250458, 31898667	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	18843278, 23696899, 24807963, 24920070, 31957824, 32588766, 32899691, 34302528, 37787719	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	28849119, 29138866, 29436648, 31660895, 35118889, 35466471, 35813477, 37283291	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	25823555, 27835588, 29659195	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26858029	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	30917918		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	17600087, 18452175, 20228781, 21224353, 22790015, 23686260, 23765903, 24507678, 25444913, 25749380, 26165228, 29416690, 30474570, 30654010, 31189742		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	BEFREE	20228781, 22974476, 23743934		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	20228781	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	23743934	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30711544		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	27677077, 29487700, 30416649		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	29487700		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	27677077, 29487700, 30416649, 9210958		★☆☆☆☆ Found in Text Mining only
Childhood Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	16056249		★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	Pubtator	22289526	Associate	★☆☆☆☆ Found in Text Mining only
Chondroma	Chondroma	BEFREE	14614053, 25250651		★☆☆☆☆ Found in Text Mining only
Chondroma	Chondroma	LHGDN	14614053		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	14614053		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10812175, 23482887		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	17574970, 21460244, 22749035, 25236537, 26697989, 29066347, 29296743		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	GWASCAT_DG	30940143		★☆☆☆☆ Found in Text Mining only
Clinodactyly of the 5th finger	Camptodactyly of fingers	HPO_DG			★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	25218351, 29255096, 30402842		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19609535, 21252160, 22939952, 26964871, 27686621, 28948632, 29109785, 29255096, 29515783, 29997523, 30175854, 30402842, 30477538, 30755600, 31067275, 31241772, 31581665, 31619685, 31684108		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	19609535		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21252160, 21533145, 30402842, 30938104, 31684108, 32842685, 35400282, 37535601	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28948632	Stimulate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	11170289, 12118328, 17372913, 18980243, 19431195, 19549901, 20055685, 22223266, 26202160, 8603366, 8954805, 8988031, 9216720, 9238692, 9466569		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	31632521		★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of kidney	Renal hypoplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital malrotation of intestine	Congenital malrotation of intestine	HPO_DG			★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28849119, 29138866, 29436648, 29568870, 29997523		★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	BEFREE	29735702		★☆☆☆☆ Found in Text Mining only
Dedifferentiated liposarcoma	Dedifferentiated Liposarcoma	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Degenerative polyarthritis	Arthritis	BEFREE	10451709, 11301347		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	23462794, 26290879, 31123324	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	22325160, 23111731, 26715663		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	22325160		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	25102180, 30054458, 30595370		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	34187448	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	23111731, 30896854		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	28584193		★☆☆☆☆ Found in Text Mining only
Diffuse Astrocytoma	Astrocytoma	BEFREE	24935062		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	31124542		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	19298872, 21267005, 22887875, 26536448, 27986804, 29501611, 29735702		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dysgerminoma	Dysgerminoma	BEFREE	28585395		★☆☆☆☆ Found in Text Mining only
Ectopic kidney	Ectopic kidney	HPO_DG			★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	31096664		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	29391048, 31632465		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	23743934	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	20461755, 22221703		★☆☆☆☆ Found in Text Mining only
Epidermolysis bullosa with pyloric atresia	Epidermolysis bullosa	Pubtator	25439740, 29437290	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	25749380, 30654010		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	28487599, 29997523		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	28487599	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	29997523		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	27027341	Stimulate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	27484584, 28169242, 28968424, 30556870, 32495874	Associate	★☆☆☆☆ Found in Text Mining only
Essential Tremor	Essential tremor	Pubtator	25236537	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	20332486		★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	31196492		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	28710822		★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	16885341, 8739083		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	17045619, 18403645, 18980243, 19602040, 20544840, 21498692, 23557758, 24390224, 24516594, 25272295, 25542836, 26107781, 26787895, 27635945, 28591699, 28592321, 30017537, 30292626, 30554729, 31659109, 9216720, 9764641		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	LHGDN	18403645		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	30289618		★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	21763631		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	18375116		★☆☆☆☆ Found in Text Mining only
Frontal bossing	Frontal bossing	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	24682444		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	34913073	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	Pubtator	35181586	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	29452408	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	15497774, 20368557, 23846349, 24332177, 24935062, 26892260, 27102002, 28848341, 29193056, 29733521		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	20368557, 22572881, 27102002	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	15497774, 20368557, 23846349, 24332177, 24935062, 26892260, 27102002, 27259253, 28848341, 29193056, 29733521, 31427735		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	24392454, 24935062, 26715270, 27259253, 29193056, 29733521, 30851271, 30860979, 31325436		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	40379848	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	21267005	Associate	★☆☆☆☆ Found in Text Mining only
Hamartoma	Hamartoma	BEFREE	10744071, 11066083, 11890997, 12063392, 12505264, 14612541, 16271958, 17001166, 17045619, 17332316, 8603366, 8637707, 9495195		★☆☆☆☆ Found in Text Mining only
Hamartoma	Hamartoma	LHGDN	12505264, 16271958		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	28830677		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	29997523		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	26799419	Inhibit	★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	16940417	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	31659109	Associate	★☆☆☆☆ Found in Text Mining only
Horseshoe Kidney	Horseshoe Kidney	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	11735131		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	24252837		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	29693142		★☆☆☆☆ Found in Text Mining only
Hypodontia	Hypodontia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	17222355	Inhibit	★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	31443718		★☆☆☆☆ Found in Text Mining only
Inflammatory Myofibroblastic Tumor	Inflammatory Myofibroblastic Tumor	BEFREE	10686944		★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	26244988		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	15161651, 23111731		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	35118889	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	27874955	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	31207579		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	16084893, 35961656	Stimulate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	18403645, 23738515, 24390224, 26043835, 26787895, 28591699, 28592321, 30292626, 31089260, 31659109, 31851934, 32108038, 32372565, 35822448, 36048862	Associate	★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	12419585, 24390224, 28592321		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	19602040, 24390224, 28514723	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma of uterus	Leiomyosarcoma Of Uterus	BEFREE	19602040		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma, Myxoid	Leiomyosarcoma	BEFREE	27717885		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	12851685, 29384529, 9446816		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	31392669	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	31173171, 31271486, 31392669, 35797243	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	26319392, 29384529, 30061630, 30820024, 31173171, 31271486, 31392669		★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	BEFREE	30535487		★☆☆☆☆ Found in Text Mining only
Lipoblastoma	Lipoblastoma	BEFREE	22223189, 25929353, 28420321		★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	BEFREE	10329012, 10519386, 10744071, 11550285, 11566348, 11890997, 12781451, 14603445, 15755872, 15882911, 16133369, 17045619, 17372913, 18551755, 18663748, 19431195, 19528502, 19837271, 20332486, 21412931, 23508853, 26043835, 26202160, 26319758, 26857357, 29025583, 8812423, 8889500, 9169041, 9403060, 9495195		★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	Pubtator	10744071, 15593017, 15618963, 15755872, 16567472, 16821597, 18383898, 19508721, 19528502, 26043835, 26202160, 26857357, 28228139, 31659109, 32108038, 33235355, 35181586, 36309352, 36881074, 7606786, 9212729, 9466569	Associate	★☆☆☆☆ Found in Text Mining only
Lipomatosis	Lipomatosis	BEFREE	10519386		★☆☆☆☆ Found in Text Mining only
Lipomatosis, Multiple	Lipomatosis	BEFREE	10329012, 11566348, 11890997, 12781451, 15882911, 16133369, 17045619, 18551755, 18663748, 19431195, 19528502, 19837271, 20332486, 26202160, 26319758, 29025583, 8812423, 9403060		★☆☆☆☆ Found in Text Mining only
Lipomatosis, Multiple Symmetrical	Lipomatosis	BEFREE	10519386		★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	11391797, 12130926, 17426251, 20332486, 21117066, 21412931		★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	16821597, 20834238, 26336885, 29610390, 31443718, 33115433, 36464833, 40540926, 9212729	Associate	★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	LHGDN	17426251, 18214854		★☆☆☆☆ Found in Text Mining only
Liposarcoma, Dedifferentiated	liposarcoma	BEFREE	18214854, 19737942, 21412931, 26336885, 31443718		★☆☆☆☆ Found in Text Mining only
Liposarcoma, Dedifferentiated	liposarcoma	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Liposarcoma, Myxoid	liposarcoma	BEFREE	10862042		★☆☆☆☆ Found in Text Mining only
Liposarcoma, well differentiated	liposarcoma	BEFREE	11391797, 12792777, 14612541, 16821597, 17001166, 17372913, 18160213, 22137485, 26336885, 9205100		★☆☆☆☆ Found in Text Mining only
Liposarcoma, well differentiated	liposarcoma	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22683924, 23097274, 24724096, 26398017, 27725724, 27773820, 27956228, 28214198, 28502886, 28522832, 28691642, 28765279, 29636997, 30356986, 30472720, 31109401, 31408273, 31562977, 31696971, 31713780, 31823639		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	28522832		★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	17332316		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17437991, 17477356, 18505920		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	17437991, 25340791, 28752530, 30569167, 35488374	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	18505920	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	BEFREE	17332316		★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	LHGDN	17332316		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	18843278, 26818837, 27874955, 34302528, 35502885, 37283291, 40213656	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26242267, 28169242, 29278873	Stimulate	★☆☆☆☆ Found in Text Mining only
Macrocephaly	Macrocephaly	BEFREE	22887875		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	24935062		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	29997523		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12778070, 16077985, 22322863, 23716660, 26285644, 27063096, 27245202, 28720546, 29473328, 29518471, 30049846, 30194979, 30220054, 30825204		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	29391048		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	29997523		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	24682444		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	30507008, 31055021, 31581665		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	27874955		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	22683924, 27956228, 28765279, 30535489, 31416393, 31823639		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17437991, 17477356, 24305048, 25340791, 28752530, 29079814, 29883241, 30317663, 30556876, 30569167, 31692094		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	26025649		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	17600087, 18452175, 20228781, 21224353, 22790015, 23686260, 23765903, 24507678, 25444913, 25749380, 26165228, 29416690, 30474570, 30654010, 31189742		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19179606, 21148071, 24920070, 25502777, 28954272, 30228296, 31118815		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23591597, 26242267, 27240983, 30177390, 31481527		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	18413822, 23135750, 25037576, 27878307, 28119367, 28337375, 28436711, 29245994, 31186705, 31249473, 31845519		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	26406941, 26960757, 29406334		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	24571540, 26684800, 31053526, 31306103		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12851685, 14647145, 15618963, 16322327, 17477356, 17943974, 17957144, 18371414, 18413822, 19658182, 20597139, 21224353, 21460244, 21536653, 21763631, 22241470, 22685420, 23135750, 23591597, 23686260, 23722545, 23765903, 24703842, 24898358, 24935062, 25037576, 26025649, 26242267, 26657872, 26892260, 27063096, 27119517, 28337375, 28423547, 28522832, 28524160, 29266325, 29307852, 29416690, 30289618, 30507008, 30825204, 30900950, 31055021, 31067275, 31147574, 31432151, 31581665, 31660895, 31684108, 31737655, 31823639, 9495195		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CTD_human_DG	18413806		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	16056249, 31053152		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	27677077, 29487700, 30416649		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25218351, 29255096, 30402842		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12778070, 16077985		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16077985, 23975428		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	23633021, 25823555, 29033353		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	23633021	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	25823555, 28852061, 40213656	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL RETARDATION, X-LINKED, SNYDER-ROBINSON TYPE	Mental retardation	GENOMICS_ENGLAND_DG	29655892		★☆☆☆☆ Found in Text Mining only
Mesangial sclerosis diffuse	Diffuse mesangial sclerosis	Pubtator	34187448	Associate	★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mild Mental Retardation	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	33639654	Associate	★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	17539914, 19521953		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	23424776	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	15618963, 16364769		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	15618963, 16364769		★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	14603445, 16364769, 18508790, 25236537, 28637665		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	29384529		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	LHGDN	17917958		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	17917968		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	17574970, 17854665, 21460244, 22749035, 25236537, 28057739, 29296743		★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	28057739	Associate	★☆☆☆☆ Found in Text Mining only
Myolipoma	Myolipoma	BEFREE	10612811, 12419585, 26857357		★☆☆☆☆ Found in Text Mining only
Myolipoma	Myolipoma	GENOMICS_ENGLAND_DG	27635945		★☆☆☆☆ Found in Text Mining only
Myxoid/Round Cell Liposarcoma	Myxoid Liposarcoma	BEFREE	10862042		★☆☆☆☆ Found in Text Mining only
Myxoma	Myxoma	BEFREE	8908160		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	25884389, 26025649, 26183485, 30536950		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	25884389, 32985354, 35388172	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10344762, 10398424, 10451709, 10469450, 10472377, 10526529, 10612811, 10744071, 10862029, 11135440, 11170289, 11301347, 11391797, 11450849, 11550285, 11839563, 11890997, 12419585, 12505264, 12649198, 12851685, 14614053, 15593017, 15882911, 16056249, 16271958, 16276091, 16322327, 16568309, 16766265, 16885341, 16990720, 17045619, 17322030, 17332316, 17437991, 17477356, 17654722, 17943974, 18202751, 18308936, 18375116, 18413822, 18452175, 18604193, 18828159, 18980243, 19431195, 19508721, 19521953, 19602040, 19654500, 19737942, 19837271, 20007691, 20055685, 20544840, 20926602, 20946527, 21224353, 21471965, 21763631, 22246783, 22974476, 23479505, 23508853, 23523371, 23557758, 23686260, 23722545, 23743934, 24106133, 24297246, 24713092, 24807963, 24893972, 24935062, 25245141, 25272295, 25444913, 25575139, 25621995, 25749380, 25823555, 26043835, 26202160, 26319758, 26428358, 26608380, 26640144, 26715270, 26837766, 26857357, 26917013, 27063096, 27102002, 27119517, 27245202, 27261623, 27262492, 27379604, 27383537, 27635945, 27686621, 27742669, 27835588, 27874955, 27878307, 27929737, 28222152, 28337375, 28373457, 28423547, 28487599, 28524160, 28533522, 28591699, 28592321, 28710822, 28948632, 29079814, 29109785, 29432944, 29738363, 29790226, 30017537, 30177390, 30220054, 30292626, 30535489, 30555485, 30654010, 30851271, 30853598, 30860979, 30999005, 31033463, 31055021, 31096664, 31118815, 31207579, 31241772, 31408273, 31432151, 31484926, 8637707, 8780382, 8946199, 8954805, 9187132, 9216720, 9466569, 9495195, 9598795, 9935200		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CTD_human_DG	18413806		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	29383160, 31746066		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	15618963	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10344762		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	30999005		★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	31053152		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	16056249, 31053152, 32606289	Associate	★☆☆☆☆ Found in Text Mining only
Nodular Goiter	Nodular Goiter	BEFREE	29406334		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	17477356, 24305048, 25368430, 26858029, 28714014, 29207105, 29278873, 29630114, 30556876, 31692094		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	20108983, 33139812, 34872017	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	23765903		★☆☆☆☆ Found in Text Mining only
Osteochondroma	Osteochondroma	Pubtator	26043835	Associate	★☆☆☆☆ Found in Text Mining only
Osteochondrosis	Osteochondrosis	BEFREE	27917442		★☆☆☆☆ Found in Text Mining only
Osteopoikilosis (disorder)	Osteopoikilosis	BEFREE	28407409		★☆☆☆☆ Found in Text Mining only
Osteopoikilosis (disorder)	Osteopoikilosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	31630797		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	33168056	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	23129384, 32883329, 33650644, 34440306, 35388973	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	26341146, 27383537, 8908160		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	22790015, 23686260, 25444913, 30474570		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	17600087, 18452175, 20228781, 21224353, 22790015, 23686260, 23765903, 24507678, 25444913, 26165228, 28423547, 29416690, 30474570, 30654010, 31189742		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	18452175		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	20228781, 22790015, 24507678, 26165228, 28423547, 30392041, 32127525	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25749380	Stimulate	★☆☆☆☆ Found in Text Mining only
Ovarian Serous Adenocarcinoma	Ovarian serous adenocarcinoma	BEFREE	20228781		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	14647145, 19179606, 21148071, 24920070, 25502777, 28954272, 30228296, 31118815		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	28524160, 30228296, 31396352		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	19179606		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	14647145, 25502777, 29596435, 36275722, 37787719	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	17786355, 18375116, 27929737, 31571903		★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	16926129, 21460244, 22017592		★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	BEFREE	22203494		★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	30719118, 30853598		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	LHGDN	16322327, 19223528		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	19136928	Associate	★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	BEFREE	20541667		★☆☆☆☆ Found in Text Mining only
Pleomorphic Lipoma	Lipoma	BEFREE	8908160		★☆☆☆☆ Found in Text Mining only
Pleomorphic salivary gland adenoma	Pleomorphic adenoma of salivary gland	Orphanet			★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	GWASCAT_DG	22885925		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	GWASDB_DG	22885925		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	29693142, 30247605		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	36809792, 37223019	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycythemia Vera	Polycythemia Vera	BEFREE	17854665, 25236537, 28057739		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	LHGDN	17854665		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	25236537, 28057739	Associate	★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	12851685		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	25014774		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	14603445, 16990584, 17976522, 18508790, 25236537, 28637665		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	LHGDN	14603445		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	11956103, 16322327, 16766265, 20347930, 22139073, 31076808		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23591597, 26242267, 27240983, 30177390, 31481527		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26242267, 30177390, 31481527, 32432734, 33978716	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	30177390		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	27513632		★☆☆☆☆ Found in Text Mining only
Pulmonary lymphangiomyomatosis	Pulmonary lymphangiomyomatosis	BEFREE	17332316		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28849119, 29138866, 29436648		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	26646104		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	14571323, 23077401, 26657872, 31033463		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	23077401, 31033463	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	24618610		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	24618610	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28802150		★☆☆☆☆ Found in Text Mining only
Russell-Silver syndrome	Russell-Silver Syndrome	BEFREE	19762329, 22887875, 25809938, 29655892		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Russell-Silver syndrome	Russell-Silver Syndrome	GENOMICS_ENGLAND_DG	29655892		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Russell-Silver syndrome	Russell-Silver Syndrome	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Salivary Gland Adenoma Pleomorphic	Salivary gland disease	Pubtator	15618963, 24516594, 29437290	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Pleomorphic Adenoma	Pleomorphic adenoma of salivary gland	BEFREE	17171686, 18828159, 29437290, 9169041		★☆☆☆☆ Found in Text Mining only
Salivary Gland Pleomorphic Adenoma	Pleomorphic adenoma of salivary gland	ORPHANET_DG	21394649, 23821214		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	20576167, 31147574, 35238118	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	9205100		★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	21853155	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	16056249	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma, Epithelioid	Sarcoma	BEFREE	31331120		★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	17935122		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	31234706		★☆☆☆☆ Found in Text Mining only
Silver-Russell syndrome due to a point mutation	Silver-Russell Syndrome	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	23508853		★☆☆☆☆ Found in Text Mining only
Specific learning disability	Specific Learning Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Splenomegaly	Splenomegaly	Pubtator	25236537	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	17477356, 24612219, 25245141, 25823555, 26858029, 28373457, 28650082, 31109142		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	21598109, 27119517, 28169242, 28968424, 30556870		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	17222355, 24145240, 26818837, 29523225, 31109142, 31109699, 33371795, 33639654, 34156675, 35409173, 35502885, 36281789, 37237385	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	30900950	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	17222355, 27742669, 30900950, 31055021		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	26818837, 27809392, 29523225, 31695410		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of vulva	Carcinoma Of Vulva	BEFREE	27835588		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	31443718		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	18413822, 23135750, 25037576, 27878307, 28119367, 28337375, 28436711, 28533522, 29245994, 31186705, 31249473, 31845519		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	17229543, 18803879, 23482887, 25172097, 28121923, 28159956, 31668113, 31845519	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	18413822		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26537313	Stimulate	★☆☆☆☆ Found in Text Mining only
Synophrys	Synophrys	HPO_DG			★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	16056249		★☆☆☆☆ Found in Text Mining only
Syringomyelia	Syringomyelia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Telomeric 22q13 Monosomy Syndrome	22q13 monosomy syndrome	Pubtator	26799419	Associate	★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	17935122		★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	28057739	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	25236537, 28057739		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	28057739	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	15291748		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	27929737, 28469731, 29025376, 31670857, 39205691	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	17943974, 21532495, 26406941, 26960757, 29406334		★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	18375116		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	17943974, 20597139, 21532495, 24516594, 26406941, 26960757, 29406334, 31660895		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	24516594, 31660895, 36281116	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	20597139, 29406334, 30223300		★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	26818837	Associate	★☆☆☆☆ Found in Text Mining only
Total anomalous pulmonary venous return	Pulmonary Venous Return Anomaly	BEFREE	30448225		★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	27179787		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	23307470, 27063096, 29281678, 29731640, 30289618, 30427358, 30563890		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	29281678, 33846810	Associate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	26837766		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	BEFREE	23743934		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24571540, 26684800, 33882126	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	27677077	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	10744071	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	10398424, 10526529, 10679920, 10744071, 10862042, 11135437, 11223542, 11450849, 11746973, 12419585, 12649198, 12874787, 17045619, 18403645, 18980243, 19132395, 19602040, 20082846, 20544840, 20804914, 21498692, 23557758, 24390224, 24446130, 24516594, 25272295, 25542836, 26107781, 26787895, 27635945, 28591699, 28592321, 29055020, 29790226, 30017537, 30292626, 30376129, 30554729, 31027501, 31659109, 8780755, 8889500, 8954805, 9216720, 9238692, 9764641		★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	HPO_DG			★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Well-differentiated liposarcoma	Liposarcoma	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations