Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8089
Gene name	YEATS domain containing 4
Gene symbol	YEATS4
Synonyms (NCBI Gene)	4930573H17RikB230215M10RikGAS41NUBI-1YAF9
Chromosome	12
Chromosome location	12q15
Summary	The protein encoded by this gene is found in the nucleoli. It has high sequence homology to human MLLT1, and yeast and human MLLT3 proteins. Both MLLT1 and MLLT3 proteins belong to a class of transcription factors, indicating that the encoded protein migh

142

Show/Hide all (142)

miRTarBase ID	miRNA	Experiments	Reference
MIRT564439	hsa-miR-8084	PAR-CLIP	20371350
MIRT564438	hsa-miR-200b-3p	PAR-CLIP	20371350
MIRT564437	hsa-miR-200c-3p	PAR-CLIP	20371350
MIRT564436	hsa-miR-429	PAR-CLIP	20371350
MIRT564435	hsa-miR-214-5p	PAR-CLIP	20371350
MIRT564434	hsa-miR-6811-3p	PAR-CLIP	20371350
MIRT564433	hsa-miR-374a-5p	PAR-CLIP	20371350
MIRT564432	hsa-miR-374b-5p	PAR-CLIP	20371350
MIRT564431	hsa-miR-6514-3p	PAR-CLIP	20371350
MIRT439272	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT439272	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT564439	hsa-miR-8084	PAR-CLIP	20371350
MIRT564438	hsa-miR-200b-3p	PAR-CLIP	20371350
MIRT564437	hsa-miR-200c-3p	PAR-CLIP	20371350
MIRT564436	hsa-miR-429	PAR-CLIP	20371350
MIRT564435	hsa-miR-214-5p	PAR-CLIP	20371350
MIRT564434	hsa-miR-6811-3p	PAR-CLIP	20371350
MIRT564433	hsa-miR-374a-5p	PAR-CLIP	20371350
MIRT564432	hsa-miR-374b-5p	PAR-CLIP	20371350
MIRT564431	hsa-miR-6514-3p	PAR-CLIP	20371350
MIRT1498480	hsa-miR-1243	CLIP-seq
MIRT1498481	hsa-miR-186	CLIP-seq
MIRT1498482	hsa-miR-218	CLIP-seq
MIRT1498483	hsa-miR-30a	CLIP-seq
MIRT1498484	hsa-miR-30b	CLIP-seq
MIRT1498485	hsa-miR-30c	CLIP-seq
MIRT1498486	hsa-miR-30d	CLIP-seq
MIRT1498487	hsa-miR-30e	CLIP-seq
MIRT1498488	hsa-miR-3133	CLIP-seq
MIRT1498489	hsa-miR-329	CLIP-seq
MIRT1498490	hsa-miR-3607-3p	CLIP-seq
MIRT1498491	hsa-miR-362-3p	CLIP-seq
MIRT1498492	hsa-miR-3654	CLIP-seq
MIRT1498493	hsa-miR-3686	CLIP-seq
MIRT1498494	hsa-miR-376a	CLIP-seq
MIRT1498495	hsa-miR-376b	CLIP-seq
MIRT1498496	hsa-miR-3941	CLIP-seq
MIRT1498497	hsa-miR-412	CLIP-seq
MIRT1498498	hsa-miR-421	CLIP-seq
MIRT1498499	hsa-miR-4310	CLIP-seq
MIRT1498500	hsa-miR-4326	CLIP-seq
MIRT1498501	hsa-miR-4638-3p	CLIP-seq
MIRT1498502	hsa-miR-4643	CLIP-seq
MIRT1498503	hsa-miR-4659a-3p	CLIP-seq
MIRT1498504	hsa-miR-4659b-3p	CLIP-seq
MIRT1498505	hsa-miR-466	CLIP-seq
MIRT1498506	hsa-miR-4670-3p	CLIP-seq
MIRT1498507	hsa-miR-4672	CLIP-seq
MIRT1498508	hsa-miR-4709-5p	CLIP-seq
MIRT1498509	hsa-miR-4720-3p	CLIP-seq
MIRT1498510	hsa-miR-4729	CLIP-seq
MIRT1498511	hsa-miR-4744	CLIP-seq
MIRT1498512	hsa-miR-4760-3p	CLIP-seq
MIRT1498513	hsa-miR-4789-3p	CLIP-seq
MIRT1498514	hsa-miR-4789-5p	CLIP-seq
MIRT1498515	hsa-miR-4804-3p	CLIP-seq
MIRT1498516	hsa-miR-487a	CLIP-seq
MIRT1498517	hsa-miR-494	CLIP-seq
MIRT1498518	hsa-miR-499-3p	CLIP-seq
MIRT1498519	hsa-miR-499a-3p	CLIP-seq
MIRT1498520	hsa-miR-505	CLIP-seq
MIRT1498521	hsa-miR-515-5p	CLIP-seq
MIRT1498522	hsa-miR-548a-3p	CLIP-seq
MIRT1498523	hsa-miR-548ac	CLIP-seq
MIRT1498524	hsa-miR-548ae	CLIP-seq
MIRT1498525	hsa-miR-548aj	CLIP-seq
MIRT1498526	hsa-miR-548am	CLIP-seq
MIRT1498527	hsa-miR-548d-3p	CLIP-seq
MIRT1498528	hsa-miR-548e	CLIP-seq
MIRT1498529	hsa-miR-548f	CLIP-seq
MIRT1498530	hsa-miR-548g	CLIP-seq
MIRT1498531	hsa-miR-548x	CLIP-seq
MIRT1498532	hsa-miR-548z	CLIP-seq
MIRT1498533	hsa-miR-587	CLIP-seq
MIRT1498534	hsa-miR-600	CLIP-seq
MIRT1498535	hsa-miR-603	CLIP-seq
MIRT1498536	hsa-miR-636	CLIP-seq
MIRT1498537	hsa-miR-642b	CLIP-seq
MIRT1498538	hsa-miR-889	CLIP-seq
MIRT1498481	hsa-miR-186	CLIP-seq
MIRT1498488	hsa-miR-3133	CLIP-seq
MIRT1498489	hsa-miR-329	CLIP-seq
MIRT1498491	hsa-miR-362-3p	CLIP-seq
MIRT1498496	hsa-miR-3941	CLIP-seq
MIRT1498498	hsa-miR-421	CLIP-seq
MIRT1498505	hsa-miR-466	CLIP-seq
MIRT1498507	hsa-miR-4672	CLIP-seq
MIRT1498508	hsa-miR-4709-5p	CLIP-seq
MIRT1498511	hsa-miR-4744	CLIP-seq
MIRT1498512	hsa-miR-4760-3p	CLIP-seq
MIRT1498513	hsa-miR-4789-3p	CLIP-seq
MIRT1498520	hsa-miR-505	CLIP-seq
MIRT1498534	hsa-miR-600	CLIP-seq
MIRT1498535	hsa-miR-603	CLIP-seq
MIRT2370364	hsa-miR-1224-3p	CLIP-seq
MIRT2370365	hsa-miR-1284	CLIP-seq
MIRT2370366	hsa-miR-146a	CLIP-seq
MIRT2370367	hsa-miR-146b-5p	CLIP-seq
MIRT2370368	hsa-miR-1825	CLIP-seq
MIRT1498481	hsa-miR-186	CLIP-seq
MIRT2370369	hsa-miR-199a-5p	CLIP-seq
MIRT2370370	hsa-miR-199b-5p	CLIP-seq
MIRT2370371	hsa-miR-21	CLIP-seq
MIRT2370372	hsa-miR-3121-3p	CLIP-seq
MIRT1498488	hsa-miR-3133	CLIP-seq
MIRT2370373	hsa-miR-338-5p	CLIP-seq
MIRT2370374	hsa-miR-3925-3p	CLIP-seq
MIRT2370375	hsa-miR-4282	CLIP-seq
MIRT2370376	hsa-miR-4328	CLIP-seq
MIRT1498505	hsa-miR-466	CLIP-seq
MIRT1498511	hsa-miR-4744	CLIP-seq
MIRT2370377	hsa-miR-4786-3p	CLIP-seq
MIRT1498513	hsa-miR-4789-3p	CLIP-seq
MIRT1498521	hsa-miR-515-5p	CLIP-seq
MIRT1498533	hsa-miR-587	CLIP-seq
MIRT2370378	hsa-miR-589	CLIP-seq
MIRT2370379	hsa-miR-590-5p	CLIP-seq
MIRT2370380	hsa-miR-766	CLIP-seq
MIRT2370381	hsa-miR-885-5p	CLIP-seq
MIRT1498498	hsa-miR-421	CLIP-seq
MIRT1498506	hsa-miR-4670-3p	CLIP-seq
MIRT1498508	hsa-miR-4709-5p	CLIP-seq
MIRT1498520	hsa-miR-505	CLIP-seq
MIRT2663989	hsa-miR-137	CLIP-seq
MIRT2370372	hsa-miR-3121-3p	CLIP-seq
MIRT1498489	hsa-miR-329	CLIP-seq
MIRT2663990	hsa-miR-337-3p	CLIP-seq
MIRT1498491	hsa-miR-362-3p	CLIP-seq
MIRT1498496	hsa-miR-3941	CLIP-seq
MIRT1498498	hsa-miR-421	CLIP-seq
MIRT2663991	hsa-miR-4639-5p	CLIP-seq
MIRT1498505	hsa-miR-466	CLIP-seq
MIRT1498507	hsa-miR-4672	CLIP-seq
MIRT1498508	hsa-miR-4709-5p	CLIP-seq
MIRT1498509	hsa-miR-4720-3p	CLIP-seq
MIRT1498512	hsa-miR-4760-3p	CLIP-seq
MIRT1498513	hsa-miR-4789-3p	CLIP-seq
MIRT1498515	hsa-miR-4804-3p	CLIP-seq
MIRT1498520	hsa-miR-505	CLIP-seq
MIRT1498533	hsa-miR-587	CLIP-seq
MIRT1498535	hsa-miR-603	CLIP-seq
MIRT2370381	hsa-miR-885-5p	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000278	Process	Mitotic cell cycle	NAS	10913114
GO:0000786	Component	Nucleosome	IDA	27153538
GO:0000786	Component	Nucleosome	NAS	16634648
GO:0005200	Function	Structural constituent of cytoskeleton	NAS	10913114
GO:0005515	Function	Protein binding	IPI	10913114, 11903063, 32296183, 32707033
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	18445686
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	10913114
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IBA
GO:0006338	Process	Chromatin remodeling	NAS	16634648
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	16634648
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007010	Process	Cytoskeleton organization	IEA
GO:0016363	Component	Nuclear matrix	NAS	10913114
GO:0031965	Component	Nuclear membrane	IDA
GO:0035267	Component	NuA4 histone acetyltransferase complex	IBA
GO:0035267	Component	NuA4 histone acetyltransferase complex	IDA	14966270, 27153538
GO:0042393	Function	Histone binding	IBA
GO:0042981	Process	Regulation of apoptotic process	NAS	14966270
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	10913114, 27153538
GO:0051726	Process	Regulation of cell cycle	IMP	27153538
GO:0140044	Function	Histone H3K18ac reader activity	IDA	30071723
GO:0140119	Function	Histone H3K27ac reader activity	IDA	30071723
GO:1905168	Process	Positive regulation of double-strand break repair via homologous recombination	IDA	27153538
GO:2000779	Process	Regulation of double-strand break repair	NAS	14966270

MIM	HGNC	e!Ensembl
602116	24859	ENSG00000127337

O95619

Protein name

YEATS domain-containing protein 4 (Glioma-amplified sequence 41) (Gas41) (NuMA-binding protein 1) (NuBI-1) (NuBI1)

Protein function

Chromatin reader component of the NuA4 histone acetyltransferase (HAT) complex, a complex involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A (PubMed:12963728, PubMed:14966270). Sp

PDB

5R68 , 5R69 , 5VNA , 5VNB , 5XTZ , 5Y8V , 7EIF , 7JFY , 8DKB , 8I60 , 8IIY , 8IIZ , 8IJ0 , 8X15 , 8X19 , 8X1C

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03366	YEATS	44 → 124	YEATS family	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain, heart, kidney, liver, lung, pancreas, placenta and skeletal muscle. {ECO:0000269|PubMed:10913114}.

Sequence

MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMS
AYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKL
FQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTR
EKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKDI

Sequence length

227

Interactions

View interactions

	KEGG		Reactome
	ATP-dependent chromatin remodeling		Activation of the TFAP2 (AP-2) family of transcription factors

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIPOSARCOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (33)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Astrocytoma	Astrocytoma	BEFREE	9302258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	22068108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26307679, 39788387	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29437725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26307679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27779719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	11756182, 22619067, 27467502	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22068108, 22619067, 9302258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22619067, 9302258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	21317290, 22619067, 39788387	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22619067, 27467502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	37092838	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	LHGDN	18214854		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
liposarcoma	Liposarcoma	CTD_human_DG	20601955		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liposarcoma	Liposarcoma	Pubtator	20601955	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liposarcoma, Dedifferentiated	liposarcoma	CTD_human_DG	20601955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma, Pleomorphic	liposarcoma	CTD_human_DG	20601955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma, well differentiated	liposarcoma	CTD_human_DG	20601955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29706630, 30416857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	29437725, 34289376	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29437725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26307679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28445953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28251887, 30662802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28251887, 29437725, 30416857, 30662802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24170126, 27467502, 30416857, 30662802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Neoplasms	Nervous System Neoplasms	BEFREE	22068108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	22068108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24170126, 29437725		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26307679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26307679	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28445953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28251887, 30662802		★★★★★ ★☆☆☆☆ Found in Text Mining only

YEATS4 (YEATS domain containing 4)