TAS1R1 (taste 1 receptor member 1)

Gene

• Entrez ID: 80835
• Gene name: Taste 1 receptor member 1
• Gene symbol: TAS1R1
• Synonyms (NCBI Gene): GM148, GPR70, T1R1, TR1
• Chromosome: 1
• Chromosome location: 1p36.31
• Summary: The protein encoded by this gene is a G protein-coupled receptor and is a component of the heterodimeric amino acid taste receptor T1R1+3. The T1R1+3 receptor responds to L-amino acids but not to D-enantiomers or other compounds. Most amino acids that are

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1411533	hsa-miR-370	CLIP-seq
MIRT1411534	hsa-miR-4763-5p	CLIP-seq
MIRT1411535	hsa-miR-550a	CLIP-seq
MIRT1411536	hsa-miR-628-5p	CLIP-seq
MIRT1411533	hsa-miR-370	CLIP-seq
MIRT1411534	hsa-miR-4763-5p	CLIP-seq
MIRT1411535	hsa-miR-550a	CLIP-seq
MIRT1411536	hsa-miR-628-5p	CLIP-seq
MIRT1411533	hsa-miR-370	CLIP-seq
MIRT1411534	hsa-miR-4763-5p	CLIP-seq
MIRT1411535	hsa-miR-550a	CLIP-seq
MIRT1411536	hsa-miR-628-5p	CLIP-seq
MIRT1411533	hsa-miR-370	CLIP-seq
MIRT1411534	hsa-miR-4763-5p	CLIP-seq
MIRT1411535	hsa-miR-550a	CLIP-seq
MIRT1411536	hsa-miR-628-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0008527	Function	Taste receptor activity	IEA
GO:0008527	Function	Taste receptor activity	IPI	11917125
GO:0016020	Component	Membrane	IC	11917125
GO:0016020	Component	Membrane	IEA
GO:0050909	Process	Sensory perception of taste	IEA
GO:0050912	Process	Detection of chemical stimulus involved in sensory perception of taste	IEA
GO:0050917	Process	Sensory perception of umami taste	IBA
GO:0050917	Process	Sensory perception of umami taste	IDA	11917125
GO:0050917	Process	Sensory perception of umami taste	IEA

Other IDs

• MIM: 606225
• HGNC: 14448
• e!Ensembl: ENSG00000173662

Protein

• UniProt ID: Q7RTX1
• Protein name: Taste receptor type 1 member 1 (G-protein coupled receptor 70)
• Protein function: Putative taste receptor. TAS1R1/TAS1R3 responds to the umami taste stimulus (the taste of monosodium glutamate). Sequence differences within and between species can significantly influence the selectivity and specificity of taste responses. {ECO
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01094	ANF_receptor	74 → 458	Receptor family ligand binding region	Family
  PF07562	NCD3G	493 → 545	Nine Cysteines Domain of family 3 GPCR	Family
  PF00003	7tm_3	576 → 814	7 transmembrane sweet-taste receptor of 3 GCPR	Family

• Sequence:

  MLLCTARLVGLQLLISCCWAFACHSTESSPDFTLPGDYLLAGLFPLHSGCLQVRHRPEVT
  LCDRSCSFNEHGYHLFQAMRLGVEEINNSTALLPNITLGYQLYDVCSDSANVYATLRVLS
  LPGQHHIELQGDLLHYSPTVLAVIGPDSTNRAATTAALLSPFLVPMISYAASSETLSVKR
  QYPSFLRTIPNDKYQVETMVLLLQKFGWTWISLVGSSDDYGQLGVQALENQATGQGICIA
  FKDIMPFSAQVGDERMQCLMRHLAQAGATVVVVFSSRQLARVFFESVVLTNLTGKVWVAS
  EAWALSRHITGVPGIQRIGMVLGVAIQKRAVPGLKAFEEAYARADKKAPRPCHKGSWCSS
  NQLCRECQAFMAHTMPKLKAFSMSSAYNAYRAVYAVAHGLHQLLGCASGACSRGRVYPWQ
  LLEQIHKVHFLLHKDTVAFNDNRDPLSSYNIIAWDWNGPKWTFTVLGSSTWSPVQLNINE
  TKIQWHGKDNQVPKSVCSSDCLEGHQRVVTGFHHCCFECVPCGAGTFLNKSDLYRCQPCG
  KEEWAPEGSQTCFPRTVVFLALREHTSWVLLAANTLLLLLLLGTAGLFAWHLDTPVVRSA
  GGRLCFLMLGSLAAGSGSLYGFFGEPTRPACLLRQALFALGFTIFLSCLTVRSFQLIIIF
  KFSTKVPTFYHAWVQNHGAGLFVMISSAAQLLICLTWLVVWTPLPAREYQRFPHLVMLEC
  TETNSLGFILAFLYNGLLSISAFACSYLGKDLPENYNEAKCVTFSLLFNFVSWIAFFTTA
  SVYDGKYLPAANMMAGLSSLSSGFGGYFLPKCYVILCRPDLNSTEHFQASIQDYTRRCGS
  T

• Sequence length: 841

Pathways

KEGG:

Taste transduction

Reactome:

G alpha (i) signalling events
Class C/3 (Metabotropic glutamate/pheromone receptors)

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
EYE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Autoimmune Diseases	Autoimmune disease	Pubtator	37192682	Associate	★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	31261961, 32578798	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	35466133	Stimulate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	25041527	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	22183068	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27321875		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	9657524		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18559587	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27321875		★☆☆☆☆ Found in Text Mining only