APOL3 (apolipoprotein L3)

Gene

• Entrez ID: 80833
• Gene name: Apolipoprotein L3
• Gene symbol: APOL3
• Synonyms (NCBI Gene): APOLIII, CG121, CG12_1, apoL-III
• Chromosome: 22
• Chromosome location: 22q12.3
• Summary: This gene is a member of the apolipoprotein L gene family, and it is present in a cluster with other family members on chromosome 22. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids, including cholesterol, and/or

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT790158	hsa-miR-1909	CLIP-seq
MIRT790159	hsa-miR-3127-5p	CLIP-seq
MIRT790160	hsa-miR-498	CLIP-seq
MIRT1933097	hsa-miR-214	CLIP-seq
MIRT1933098	hsa-miR-329	CLIP-seq
MIRT1933099	hsa-miR-3619-5p	CLIP-seq
MIRT1933100	hsa-miR-362-3p	CLIP-seq
MIRT1933101	hsa-miR-3941	CLIP-seq
MIRT1933102	hsa-miR-4291	CLIP-seq
MIRT1933103	hsa-miR-466	CLIP-seq
MIRT1933104	hsa-miR-4672	CLIP-seq
MIRT1933105	hsa-miR-512-5p	CLIP-seq
MIRT1933106	hsa-miR-603	CLIP-seq
MIRT1933107	hsa-miR-761	CLIP-seq
MIRT1933108	hsa-miR-922	CLIP-seq
MIRT2426379	hsa-miR-3120-5p	CLIP-seq
MIRT2426380	hsa-miR-3152-5p	CLIP-seq
MIRT2426381	hsa-miR-370	CLIP-seq
MIRT2426382	hsa-miR-4718	CLIP-seq
MIRT2426383	hsa-miR-4753-3p	CLIP-seq
MIRT2426384	hsa-miR-4763-5p	CLIP-seq
MIRT2426385	hsa-miR-4774-3p	CLIP-seq
MIRT2426386	hsa-miR-593	CLIP-seq
MIRT2675174	hsa-miR-141	CLIP-seq
MIRT2675175	hsa-miR-200a	CLIP-seq
MIRT2675176	hsa-miR-3157-3p	CLIP-seq
MIRT2675177	hsa-miR-3200-3p	CLIP-seq
MIRT2675178	hsa-miR-4290	CLIP-seq
MIRT2675179	hsa-miR-4724-3p	CLIP-seq
MIRT1933105	hsa-miR-512-5p	CLIP-seq
MIRT2675180	hsa-miR-874	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005319	Function	Lipid transporter activity	TAS	10233894
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0006869	Process	Lipid transport	IEA
GO:0006954	Process	Inflammatory response	TAS	10233894
GO:0008289	Function	Lipid binding	IBA
GO:0008289	Function	Lipid binding	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0042157	Process	Lipoprotein metabolic process	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	HMP	12761501

Other IDs

• MIM: 607253
• HGNC: 14868
• e!Ensembl: ENSG00000128284

Protein

• UniProt ID: O95236
• Protein name: Apolipoprotein L3 (Apolipoprotein L-III) (ApoL-III) (TNF-inducible protein CG12-1) (CG12_1)
• Protein function: May affect the movement of lipids in the cytoplasm or allow the binding of lipids to organelles.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05461	ApoL	90 → 396	Apolipoprotein L	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed; the highest levels are in prostate, lung and placenta; also detected in kidney, bone marrow, spleen, thymus, spinal cord, adrenal gland, salivary gland, trachea and mammary gland; levels are low in brain, heart, fetal
• Sequence:

  MGLGQGWGWEASCFACLIRSCCQVVTFTFPFGFQGISQSLENVSGYYADARLEVGSTQLR
  TAGSCSHSFKRSFLEKKRFTEEATKYFRERVSPVHLQILLTNNEAWKRFVTAAELPRDEA
  DALYEALKKLRTYAAIEDEYVQQKDEQFREWFLKEFPQVKRKIQESIEKLRALANGIEEV
  HRGCTISNVVSSSTGAASGIMSLAGLVLAPFTAGTSLALTAAGVGLGAASAVTGITTSIV
  EHSYTSSAEAEASRLTATSIDRLKVFKEVMRDITPNLLSLLNNYYEATQTIGSEIRAIRQ
  ARARARLPVTTWRISAGSGGQAERTIAGTTRAVSRGARILSATTSGIFLALDVVNLVYES
  KHLHEGAKSASAEELRRQAQELEENLMELTQIYQRLNPCHTH

• Sequence length: 402

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANDIDEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Neoplasms	Breast neoplasm	Pubtator	35919504	Associate	★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	26343748, 28339911		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35213358, 36923931, 37986654, 39844333	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	24385048	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	24385048	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	28339911	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28339911		★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	27193023	Stimulate	★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	20631155		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	27779208	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	24385048, 32187552	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	26343748		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	24385048, 28339911	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	26343748, 28339911		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	30558617	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	24658608	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20631155		★☆☆☆☆ Found in Text Mining only
Prostate cancer familial	Prostate cancer	Pubtator	20631155	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20631155		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20631155	Associate	★☆☆☆☆ Found in Text Mining only