Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	80790
Gene name	C-Maf inducing protein
Gene symbol	CMIP
Synonyms (NCBI Gene)	TCMIP
Chromosome	16
Chromosome location	16q23.2-q23.3
Summary	This gene encodes a c-Maf inducing protein that plays a role in T-cell signaling pathway. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Aug 2011]

301

Show/Hide all (301)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028209	hsa-miR-33a-5p	Sequencing	20371350
MIRT558688	hsa-miR-3121-3p	PAR-CLIP	21572407
MIRT558687	hsa-miR-3529-3p	PAR-CLIP	21572407
MIRT195826	hsa-miR-302a-5p	PAR-CLIP	21572407
MIRT558686	hsa-miR-200c-5p	PAR-CLIP	21572407
MIRT558685	hsa-miR-550a-3p	PAR-CLIP	21572407
MIRT558684	hsa-miR-3924	PAR-CLIP	21572407
MIRT558683	hsa-let-7c-3p	PAR-CLIP	21572407
MIRT558688	hsa-miR-3121-3p	PAR-CLIP	21572407
MIRT558687	hsa-miR-3529-3p	PAR-CLIP	21572407
MIRT195826	hsa-miR-302a-5p	PAR-CLIP	21572407
MIRT558686	hsa-miR-200c-5p	PAR-CLIP	21572407
MIRT558685	hsa-miR-550a-3p	PAR-CLIP	21572407
MIRT558684	hsa-miR-3924	PAR-CLIP	21572407
MIRT558683	hsa-let-7c-3p	PAR-CLIP	21572407
MIRT898496	hsa-miR-1197	CLIP-seq
MIRT898497	hsa-miR-1224-5p	CLIP-seq
MIRT898498	hsa-miR-1269	CLIP-seq
MIRT898499	hsa-miR-1269b	CLIP-seq
MIRT898500	hsa-miR-1288	CLIP-seq
MIRT898501	hsa-miR-129-5p	CLIP-seq
MIRT898502	hsa-miR-1324	CLIP-seq
MIRT898503	hsa-miR-153	CLIP-seq
MIRT898504	hsa-miR-185	CLIP-seq
MIRT898505	hsa-miR-1915	CLIP-seq
MIRT898506	hsa-miR-199a-3p	CLIP-seq
MIRT898507	hsa-miR-199b-3p	CLIP-seq
MIRT898508	hsa-miR-2110	CLIP-seq
MIRT898509	hsa-miR-28-5p	CLIP-seq
MIRT898510	hsa-miR-3120-3p	CLIP-seq
MIRT898511	hsa-miR-3129-5p	CLIP-seq
MIRT898512	hsa-miR-3139	CLIP-seq
MIRT898513	hsa-miR-3144-5p	CLIP-seq
MIRT898514	hsa-miR-3150a-3p	CLIP-seq
MIRT898515	hsa-miR-3151	CLIP-seq
MIRT898516	hsa-miR-3152-5p	CLIP-seq
MIRT898517	hsa-miR-3153	CLIP-seq
MIRT898518	hsa-miR-3163	CLIP-seq
MIRT898519	hsa-miR-3166	CLIP-seq
MIRT898520	hsa-miR-3191	CLIP-seq
MIRT898521	hsa-miR-34b	CLIP-seq
MIRT898522	hsa-miR-3605-3p	CLIP-seq
MIRT898523	hsa-miR-3622b-5p	CLIP-seq
MIRT898524	hsa-miR-3689d	CLIP-seq
MIRT898525	hsa-miR-3908	CLIP-seq
MIRT898526	hsa-miR-3942-5p	CLIP-seq
MIRT898527	hsa-miR-410	CLIP-seq
MIRT898528	hsa-miR-4271	CLIP-seq
MIRT898529	hsa-miR-4292	CLIP-seq
MIRT898530	hsa-miR-4306	CLIP-seq
MIRT898531	hsa-miR-4308	CLIP-seq
MIRT898532	hsa-miR-431	CLIP-seq
MIRT898533	hsa-miR-4318	CLIP-seq
MIRT898534	hsa-miR-4443	CLIP-seq
MIRT898535	hsa-miR-4447	CLIP-seq
MIRT898536	hsa-miR-4464	CLIP-seq
MIRT898537	hsa-miR-4472	CLIP-seq
MIRT898538	hsa-miR-448	CLIP-seq
MIRT898539	hsa-miR-4481	CLIP-seq
MIRT898540	hsa-miR-4515	CLIP-seq
MIRT898541	hsa-miR-4644	CLIP-seq
MIRT898542	hsa-miR-4645-3p	CLIP-seq
MIRT898543	hsa-miR-4651	CLIP-seq
MIRT898544	hsa-miR-4652-5p	CLIP-seq
MIRT898545	hsa-miR-4655-5p	CLIP-seq
MIRT898546	hsa-miR-4672	CLIP-seq
MIRT898547	hsa-miR-4684-3p	CLIP-seq
MIRT898548	hsa-miR-4700-3p	CLIP-seq
MIRT898549	hsa-miR-4703-5p	CLIP-seq
MIRT898550	hsa-miR-4709-5p	CLIP-seq
MIRT898551	hsa-miR-4710	CLIP-seq
MIRT898552	hsa-miR-4725-3p	CLIP-seq
MIRT898553	hsa-miR-4737	CLIP-seq
MIRT898554	hsa-miR-4740-5p	CLIP-seq
MIRT898555	hsa-miR-4745-5p	CLIP-seq
MIRT898556	hsa-miR-4748	CLIP-seq
MIRT898557	hsa-miR-4751	CLIP-seq
MIRT898558	hsa-miR-4766-3p	CLIP-seq
MIRT898559	hsa-miR-4766-5p	CLIP-seq
MIRT898560	hsa-miR-4774-3p	CLIP-seq
MIRT898561	hsa-miR-4779	CLIP-seq
MIRT898562	hsa-miR-4792	CLIP-seq
MIRT898563	hsa-miR-4797-5p	CLIP-seq
MIRT898564	hsa-miR-491-5p	CLIP-seq
MIRT898565	hsa-miR-518a-5p	CLIP-seq
MIRT898566	hsa-miR-527	CLIP-seq
MIRT898567	hsa-miR-542-3p	CLIP-seq
MIRT898568	hsa-miR-545	CLIP-seq
MIRT898569	hsa-miR-548l	CLIP-seq
MIRT898570	hsa-miR-582-5p	CLIP-seq
MIRT898571	hsa-miR-600	CLIP-seq
MIRT898572	hsa-miR-608	CLIP-seq
MIRT898573	hsa-miR-637	CLIP-seq
MIRT898574	hsa-miR-708	CLIP-seq
MIRT898575	hsa-miR-765	CLIP-seq
MIRT898576	hsa-miR-873	CLIP-seq
MIRT898577	hsa-miR-943	CLIP-seq
MIRT898578	hsa-miR-101	CLIP-seq
MIRT898579	hsa-miR-1260	CLIP-seq
MIRT898580	hsa-miR-1260b	CLIP-seq
MIRT898581	hsa-miR-134	CLIP-seq
MIRT898582	hsa-miR-144	CLIP-seq
MIRT898583	hsa-miR-188-3p	CLIP-seq
MIRT898584	hsa-miR-1908	CLIP-seq
MIRT898585	hsa-miR-193a-5p	CLIP-seq
MIRT898506	hsa-miR-199a-3p	CLIP-seq
MIRT898507	hsa-miR-199b-3p	CLIP-seq
MIRT898586	hsa-miR-208a	CLIP-seq
MIRT898587	hsa-miR-208b	CLIP-seq
MIRT898508	hsa-miR-2110	CLIP-seq
MIRT898588	hsa-miR-2113	CLIP-seq
MIRT898589	hsa-miR-218	CLIP-seq
MIRT898590	hsa-miR-219-1-3p	CLIP-seq
MIRT898591	hsa-miR-23a	CLIP-seq
MIRT898592	hsa-miR-23b	CLIP-seq
MIRT898593	hsa-miR-23c	CLIP-seq
MIRT898509	hsa-miR-28-5p	CLIP-seq
MIRT898594	hsa-miR-299-5p	CLIP-seq
MIRT898595	hsa-miR-3118	CLIP-seq
MIRT898511	hsa-miR-3129-5p	CLIP-seq
MIRT898512	hsa-miR-3139	CLIP-seq
MIRT898596	hsa-miR-3141	CLIP-seq
MIRT898513	hsa-miR-3144-5p	CLIP-seq
MIRT898514	hsa-miR-3150a-3p	CLIP-seq
MIRT898515	hsa-miR-3151	CLIP-seq
MIRT898516	hsa-miR-3152-5p	CLIP-seq
MIRT898517	hsa-miR-3153	CLIP-seq
MIRT898597	hsa-miR-3156-3p	CLIP-seq
MIRT898598	hsa-miR-3164	CLIP-seq
MIRT898599	hsa-miR-3175	CLIP-seq
MIRT898520	hsa-miR-3191	CLIP-seq
MIRT898600	hsa-miR-3194-3p	CLIP-seq
MIRT898601	hsa-miR-335	CLIP-seq
MIRT898602	hsa-miR-342-5p	CLIP-seq
MIRT898603	hsa-miR-3616-3p	CLIP-seq
MIRT898523	hsa-miR-3622b-5p	CLIP-seq
MIRT898604	hsa-miR-3646	CLIP-seq
MIRT898605	hsa-miR-3649	CLIP-seq
MIRT898606	hsa-miR-3655	CLIP-seq
MIRT898607	hsa-miR-3660	CLIP-seq
MIRT898608	hsa-miR-3662	CLIP-seq
MIRT898609	hsa-miR-3665	CLIP-seq
MIRT898524	hsa-miR-3689d	CLIP-seq
MIRT898610	hsa-miR-3929	CLIP-seq
MIRT898528	hsa-miR-4271	CLIP-seq
MIRT898529	hsa-miR-4292	CLIP-seq
MIRT898531	hsa-miR-4308	CLIP-seq
MIRT898532	hsa-miR-431	CLIP-seq
MIRT898533	hsa-miR-4318	CLIP-seq
MIRT898611	hsa-miR-4419b	CLIP-seq
MIRT898612	hsa-miR-4422	CLIP-seq
MIRT898613	hsa-miR-4436b-3p	CLIP-seq
MIRT898534	hsa-miR-4443	CLIP-seq
MIRT898614	hsa-miR-4446-5p	CLIP-seq
MIRT898535	hsa-miR-4447	CLIP-seq
MIRT898536	hsa-miR-4464	CLIP-seq
MIRT898537	hsa-miR-4472	CLIP-seq
MIRT898615	hsa-miR-4476	CLIP-seq
MIRT898616	hsa-miR-4478	CLIP-seq
MIRT898617	hsa-miR-4488	CLIP-seq
MIRT898618	hsa-miR-4501	CLIP-seq
MIRT898619	hsa-miR-4526	CLIP-seq
MIRT898620	hsa-miR-4642	CLIP-seq
MIRT898542	hsa-miR-4645-3p	CLIP-seq
MIRT898621	hsa-miR-4646-3p	CLIP-seq
MIRT898622	hsa-miR-4648	CLIP-seq
MIRT898623	hsa-miR-4649-5p	CLIP-seq
MIRT898543	hsa-miR-4651	CLIP-seq
MIRT898544	hsa-miR-4652-5p	CLIP-seq
MIRT898624	hsa-miR-4659a-3p	CLIP-seq
MIRT898625	hsa-miR-4659b-3p	CLIP-seq
MIRT898626	hsa-miR-4660	CLIP-seq
MIRT898627	hsa-miR-4664-5p	CLIP-seq
MIRT898546	hsa-miR-4672	CLIP-seq
MIRT898628	hsa-miR-4685-5p	CLIP-seq
MIRT898629	hsa-miR-4687-3p	CLIP-seq
MIRT898630	hsa-miR-4697-5p	CLIP-seq
MIRT898550	hsa-miR-4709-5p	CLIP-seq
MIRT898552	hsa-miR-4725-3p	CLIP-seq
MIRT898631	hsa-miR-4728-5p	CLIP-seq
MIRT898632	hsa-miR-4733-3p	CLIP-seq
MIRT898633	hsa-miR-4734	CLIP-seq
MIRT898553	hsa-miR-4737	CLIP-seq
MIRT898556	hsa-miR-4748	CLIP-seq
MIRT898634	hsa-miR-4753-3p	CLIP-seq
MIRT898559	hsa-miR-4766-5p	CLIP-seq
MIRT898560	hsa-miR-4774-3p	CLIP-seq
MIRT898635	hsa-miR-4778-3p	CLIP-seq
MIRT898561	hsa-miR-4779	CLIP-seq
MIRT898636	hsa-miR-4787-5p	CLIP-seq
MIRT898637	hsa-miR-4789-5p	CLIP-seq
MIRT898638	hsa-miR-490-3p	CLIP-seq
MIRT898564	hsa-miR-491-5p	CLIP-seq
MIRT898639	hsa-miR-499-5p	CLIP-seq
MIRT898640	hsa-miR-511	CLIP-seq
MIRT898567	hsa-miR-542-3p	CLIP-seq
MIRT898641	hsa-miR-548aa	CLIP-seq
MIRT898569	hsa-miR-548l	CLIP-seq
MIRT898642	hsa-miR-564	CLIP-seq
MIRT898643	hsa-miR-578	CLIP-seq
MIRT898572	hsa-miR-608	CLIP-seq
MIRT898573	hsa-miR-637	CLIP-seq
MIRT898644	hsa-miR-663	CLIP-seq
MIRT898574	hsa-miR-708	CLIP-seq
MIRT898575	hsa-miR-765	CLIP-seq
MIRT898576	hsa-miR-873	CLIP-seq
MIRT898645	hsa-miR-939	CLIP-seq
MIRT898577	hsa-miR-943	CLIP-seq
MIRT898503	hsa-miR-153	CLIP-seq
MIRT898586	hsa-miR-208a	CLIP-seq
MIRT898587	hsa-miR-208b	CLIP-seq
MIRT898590	hsa-miR-219-1-3p	CLIP-seq
MIRT898591	hsa-miR-23a	CLIP-seq
MIRT898592	hsa-miR-23b	CLIP-seq
MIRT898593	hsa-miR-23c	CLIP-seq
MIRT898594	hsa-miR-299-5p	CLIP-seq
MIRT1966444	hsa-miR-3130-5p	CLIP-seq
MIRT898521	hsa-miR-34b	CLIP-seq
MIRT898604	hsa-miR-3646	CLIP-seq
MIRT898605	hsa-miR-3649	CLIP-seq
MIRT898608	hsa-miR-3662	CLIP-seq
MIRT898525	hsa-miR-3908	CLIP-seq
MIRT898526	hsa-miR-3942-5p	CLIP-seq
MIRT898612	hsa-miR-4422	CLIP-seq
MIRT1966445	hsa-miR-4432	CLIP-seq
MIRT1966446	hsa-miR-4463	CLIP-seq
MIRT898538	hsa-miR-448	CLIP-seq
MIRT1966447	hsa-miR-4482	CLIP-seq
MIRT898620	hsa-miR-4642	CLIP-seq
MIRT898622	hsa-miR-4648	CLIP-seq
MIRT898628	hsa-miR-4685-5p	CLIP-seq
MIRT898549	hsa-miR-4703-5p	CLIP-seq
MIRT898632	hsa-miR-4733-3p	CLIP-seq
MIRT898558	hsa-miR-4766-3p	CLIP-seq
MIRT898559	hsa-miR-4766-5p	CLIP-seq
MIRT898639	hsa-miR-499-5p	CLIP-seq
MIRT898569	hsa-miR-548l	CLIP-seq
MIRT898642	hsa-miR-564	CLIP-seq
MIRT898513	hsa-miR-3144-5p	CLIP-seq
MIRT898518	hsa-miR-3163	CLIP-seq
MIRT898543	hsa-miR-4651	CLIP-seq
MIRT898564	hsa-miR-491-5p	CLIP-seq
MIRT898572	hsa-miR-608	CLIP-seq
MIRT1966445	hsa-miR-4432	CLIP-seq
MIRT2386252	hsa-miR-1207-5p	CLIP-seq
MIRT2386253	hsa-miR-1909	CLIP-seq
MIRT898505	hsa-miR-1915	CLIP-seq
MIRT898586	hsa-miR-208a	CLIP-seq
MIRT898587	hsa-miR-208b	CLIP-seq
MIRT1966444	hsa-miR-3130-5p	CLIP-seq
MIRT898513	hsa-miR-3144-5p	CLIP-seq
MIRT898520	hsa-miR-3191	CLIP-seq
MIRT898604	hsa-miR-3646	CLIP-seq
MIRT898608	hsa-miR-3662	CLIP-seq
MIRT898609	hsa-miR-3665	CLIP-seq
MIRT898524	hsa-miR-3689d	CLIP-seq
MIRT898525	hsa-miR-3908	CLIP-seq
MIRT898526	hsa-miR-3942-5p	CLIP-seq
MIRT1966445	hsa-miR-4432	CLIP-seq
MIRT898534	hsa-miR-4443	CLIP-seq
MIRT898535	hsa-miR-4447	CLIP-seq
MIRT1966446	hsa-miR-4463	CLIP-seq
MIRT898536	hsa-miR-4464	CLIP-seq
MIRT898537	hsa-miR-4472	CLIP-seq
MIRT1966447	hsa-miR-4482	CLIP-seq
MIRT898544	hsa-miR-4652-5p	CLIP-seq
MIRT898549	hsa-miR-4703-5p	CLIP-seq
MIRT2386254	hsa-miR-4716-3p	CLIP-seq
MIRT2386255	hsa-miR-4723-5p	CLIP-seq
MIRT898556	hsa-miR-4748	CLIP-seq
MIRT2386256	hsa-miR-4763-3p	CLIP-seq
MIRT898558	hsa-miR-4766-3p	CLIP-seq
MIRT898635	hsa-miR-4778-3p	CLIP-seq
MIRT898564	hsa-miR-491-5p	CLIP-seq
MIRT898639	hsa-miR-499-5p	CLIP-seq
MIRT898567	hsa-miR-542-3p	CLIP-seq
MIRT898642	hsa-miR-564	CLIP-seq
MIRT898575	hsa-miR-765	CLIP-seq
MIRT898645	hsa-miR-939	CLIP-seq
MIRT898508	hsa-miR-2110	CLIP-seq
MIRT898509	hsa-miR-28-5p	CLIP-seq
MIRT898512	hsa-miR-3139	CLIP-seq
MIRT898528	hsa-miR-4271	CLIP-seq
MIRT898529	hsa-miR-4292	CLIP-seq
MIRT898531	hsa-miR-4308	CLIP-seq
MIRT898543	hsa-miR-4651	CLIP-seq
MIRT898552	hsa-miR-4725-3p	CLIP-seq
MIRT898564	hsa-miR-491-5p	CLIP-seq
MIRT898572	hsa-miR-608	CLIP-seq
MIRT898573	hsa-miR-637	CLIP-seq
MIRT898574	hsa-miR-708	CLIP-seq
MIRT898517	hsa-miR-3153	CLIP-seq
MIRT898641	hsa-miR-548aa	CLIP-seq
MIRT2447284	hsa-miR-625	CLIP-seq
MIRT898517	hsa-miR-3153	CLIP-seq
MIRT898641	hsa-miR-548aa	CLIP-seq
MIRT2447284	hsa-miR-625	CLIP-seq
MIRT898517	hsa-miR-3153	CLIP-seq
MIRT898641	hsa-miR-548aa	CLIP-seq
MIRT2447284	hsa-miR-625	CLIP-seq
MIRT898641	hsa-miR-548aa	CLIP-seq

Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001701	Process	In utero embryonic development	IEA
GO:0005515	Function	Protein binding	IPI	20018188, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA

MIM	HGNC	e!Ensembl
610112	24319	ENSG00000153815

Q8IY22

Protein name

C-Maf-inducing protein (c-Mip) (Truncated c-Maf-inducing protein) (Tc-Mip)

Protein function

Plays a role in T-cell signaling pathway. Isoform 2 may play a role in T-helper 2 (Th2) signaling pathway and seems to represent the first proximal signaling protein that links T-cell receptor-mediated signal to the activation of c-Maf Th2 speci

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Isoform 1 is expressed in peripheral blood mononuclear cells and kidney. Lower expression in brain and liver. Expression is down-regulated in activated cells. Isoform 2 is expressed in lymphocyte precursors, however, expression shuts d

Sequence

MDVTSSSGGGGDPRQIEETKPLLGGDVSAPEGTKMGAVPCRRALLLCNGMRYKLLQEGDI
QVCVIRHPRTFLSKILTSKFLRRWEPHHLTLADNSLASATPTGYMENSVSYSAIEDVQLL
SWENAPKYCLQLTIPGGTVLLQAANSYLRDQWFHSLQWKKKIYKYKKVLSNPSRWEVVLK
EIRTLVDMALTSPLQDDSINQAPLEIVSKLLSENTNLTTQEHENIIVAIAPLLENNHPPP
DLCEFFCKHCRERPRSMVVIEVFTPVVQRILKHNMDFGKCPRLRLFTQEYILALNELNAG
MEVVKKFIQSMHGPTGHCPHPRVLPNLVAVCLAAIYSCYEEFINSRDNSPSLKEIRNGCQ
QPCDRKPTLPLRLLHPSPDLVSQEATLSEARLKSVVVASSEIHVEVERTSTAKPALTASA
GNDSEPNLIDCLMVSPACSTMSIELGPQADRTLGCYVEILKLLSDYDDWRPSLASLLQPI
PFPKEALAHEKFTKELKYVIQRFAEDPRQEVHSCLLSVRAGKDGWFQLYSPGGVACDDDG
ELFASMVHILMGSCYKTKKFLLSLAENKLGPCMLLALRGNQTMVEILCLMLEYNIIDNND
TQLQIISTLESTDVGKRMYEQLCDRQRELKELQRKGGPTRLTLPSKSTDADLARLLSSGS
FGNLENLSLAFTNVTSACAEHLIKLPSLKQLNLWSTQFGDAGLRLLSEHLTMLQVLNLCE
TPVTDAGLLALSSMKSLCSLNMNSTKLSADTYEDLKAKLPNLKEVDVRYTEAW

Sequence length

773

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (24)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CMIP-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal atresia	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
FAMILIAL HYPERLIPIDEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALIGNANT EPITHELIAL TUMOR OF OVARY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pyloric stenosis	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (45)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	28944848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	22689534, 28504353		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	24086726, 29597287, 29691896, 31145772	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	22158537		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	22158537, 28566273, 28869590, 30054458		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	28869590		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29597287, 29691896, 31145772		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dyslexia	Dyslexia	BEFREE	21165691, 24769279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28744466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28744466	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	22689534, 28504353		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	33112407	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	23302718	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematuria	Hematuria	Pubtator	30439969	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	23302718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	28791377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	30439969	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Language Disorders	Language Disorders	BEFREE	19646677, 21457949, 23228431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Language Disorders	Language development disorders	Pubtator	19646677, 21457949	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	30439969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	30439969	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28302763, 29105797, 31502084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28944848, 31822364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29401151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	24906614	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	29916921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28744466, 31822364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	27650733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrosis congenital	Nephrotic syndrome	Pubtator	23302718	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrosis Lipoid	Nephrotic syndrome	Pubtator	12939343, 28944848, 30458703	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	20484117, 28063735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome, Minimal Change	Nephrotic Syndrome	BEFREE	23302718, 28944848, 30458703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29597287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29597287	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	GWASCAT_DG	30898391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	22689534, 28504353		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28302763, 29105797, 31502084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	23302718	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	28063735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Specific Language Disorder	Specific language disorder	Pubtator	19646677	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Specific language impairment	Specific Language Impairment	BEFREE	19646677, 22365959, 22689534, 28504353		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28944848, 31822364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28944848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CMIP (c-Maf inducing protein)