Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	80762
Gene name	Nedd4 family interacting protein 1
Gene symbol	NDFIP1
Synonyms (NCBI Gene)	N4WBP5
Chromosome	5
Chromosome location	5q31.3
Summary	The protein encoded by this gene belongs to a small group of evolutionarily conserved proteins with three transmembrane domains. It is a potential target for ubiquitination by the Nedd4 family of proteins. This protein is thought to be part of a family of

239

Show/Hide all (239)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024174	hsa-miR-221-3p	Sequencing	20371350
MIRT028563	hsa-miR-30a-5p	Proteomics	18668040
MIRT048220	hsa-miR-196a-5p	CLASH	23622248
MIRT046433	hsa-miR-15b-5p	CLASH	23622248
MIRT043897	hsa-miR-378a-3p	CLASH	23622248
MIRT437541	hsa-miR-19b-3p	Immunoprecipitaion	22382630
MIRT1177954	hsa-miR-1178	CLIP-seq
MIRT1177955	hsa-miR-1267	CLIP-seq
MIRT1177956	hsa-miR-1284	CLIP-seq
MIRT1177957	hsa-miR-129-5p	CLIP-seq
MIRT1177958	hsa-miR-1305	CLIP-seq
MIRT1177959	hsa-miR-221	CLIP-seq
MIRT1177960	hsa-miR-222	CLIP-seq
MIRT1177961	hsa-miR-24	CLIP-seq
MIRT1177962	hsa-miR-3143	CLIP-seq
MIRT1177963	hsa-miR-3145-3p	CLIP-seq
MIRT1177964	hsa-miR-3162-3p	CLIP-seq
MIRT1177965	hsa-miR-335	CLIP-seq
MIRT1177966	hsa-miR-3613-5p	CLIP-seq
MIRT1177967	hsa-miR-3614-5p	CLIP-seq
MIRT1177968	hsa-miR-3657	CLIP-seq
MIRT1177969	hsa-miR-3662	CLIP-seq
MIRT1177970	hsa-miR-371-5p	CLIP-seq
MIRT1177971	hsa-miR-374c	CLIP-seq
MIRT1177972	hsa-miR-409-3p	CLIP-seq
MIRT1177973	hsa-miR-4272	CLIP-seq
MIRT1177974	hsa-miR-4284	CLIP-seq
MIRT1177975	hsa-miR-4313	CLIP-seq
MIRT1177976	hsa-miR-4325	CLIP-seq
MIRT1177977	hsa-miR-4328	CLIP-seq
MIRT1177978	hsa-miR-4477a	CLIP-seq
MIRT1177979	hsa-miR-450b-5p	CLIP-seq
MIRT1177980	hsa-miR-4652-3p	CLIP-seq
MIRT1177981	hsa-miR-4669	CLIP-seq
MIRT1177982	hsa-miR-4696	CLIP-seq
MIRT1177983	hsa-miR-4699-3p	CLIP-seq
MIRT1177984	hsa-miR-4700-3p	CLIP-seq
MIRT1177985	hsa-miR-4731-3p	CLIP-seq
MIRT1177986	hsa-miR-4801	CLIP-seq
MIRT1177987	hsa-miR-4803	CLIP-seq
MIRT1177988	hsa-miR-499-3p	CLIP-seq
MIRT1177989	hsa-miR-499a-3p	CLIP-seq
MIRT1177990	hsa-miR-499a-5p	CLIP-seq
MIRT1177991	hsa-miR-507	CLIP-seq
MIRT1177992	hsa-miR-513a-5p	CLIP-seq
MIRT1177993	hsa-miR-548p	CLIP-seq
MIRT1177994	hsa-miR-548v	CLIP-seq
MIRT1177995	hsa-miR-557	CLIP-seq
MIRT1177996	hsa-miR-582-5p	CLIP-seq
MIRT1177997	hsa-miR-607	CLIP-seq
MIRT1177998	hsa-miR-635	CLIP-seq
MIRT1177999	hsa-miR-655	CLIP-seq
MIRT1178000	hsa-miR-888	CLIP-seq
MIRT1177969	hsa-miR-3662	CLIP-seq
MIRT1551642	hsa-miR-4528	CLIP-seq
MIRT1551643	hsa-miR-544	CLIP-seq
MIRT1551644	hsa-miR-875-3p	CLIP-seq
MIRT1177967	hsa-miR-3614-5p	CLIP-seq
MIRT1177998	hsa-miR-635	CLIP-seq
MIRT1177971	hsa-miR-374c	CLIP-seq
MIRT1177978	hsa-miR-4477a	CLIP-seq
MIRT1177988	hsa-miR-499-3p	CLIP-seq
MIRT1177989	hsa-miR-499a-3p	CLIP-seq
MIRT1177990	hsa-miR-499a-5p	CLIP-seq
MIRT1177999	hsa-miR-655	CLIP-seq
MIRT1177971	hsa-miR-374c	CLIP-seq
MIRT1177978	hsa-miR-4477a	CLIP-seq
MIRT1177988	hsa-miR-499-3p	CLIP-seq
MIRT1177989	hsa-miR-499a-3p	CLIP-seq
MIRT1177990	hsa-miR-499a-5p	CLIP-seq
MIRT1177999	hsa-miR-655	CLIP-seq
MIRT1177971	hsa-miR-374c	CLIP-seq
MIRT1177978	hsa-miR-4477a	CLIP-seq
MIRT1177988	hsa-miR-499-3p	CLIP-seq
MIRT1177989	hsa-miR-499a-3p	CLIP-seq
MIRT1177990	hsa-miR-499a-5p	CLIP-seq
MIRT1177999	hsa-miR-655	CLIP-seq
MIRT2051494	hsa-miR-101	CLIP-seq
MIRT2051495	hsa-miR-1206	CLIP-seq
MIRT1177957	hsa-miR-129-5p	CLIP-seq
MIRT2051496	hsa-miR-2115	CLIP-seq
MIRT2051497	hsa-miR-338-3p	CLIP-seq
MIRT2051498	hsa-miR-338-5p	CLIP-seq
MIRT1177967	hsa-miR-3614-5p	CLIP-seq
MIRT2051499	hsa-miR-3658	CLIP-seq
MIRT1177969	hsa-miR-3662	CLIP-seq
MIRT2051500	hsa-miR-3934	CLIP-seq
MIRT2051501	hsa-miR-3977	CLIP-seq
MIRT2051502	hsa-miR-410	CLIP-seq
MIRT2051503	hsa-miR-4310	CLIP-seq
MIRT1177976	hsa-miR-4325	CLIP-seq
MIRT2051504	hsa-miR-4435	CLIP-seq
MIRT1177979	hsa-miR-450b-5p	CLIP-seq
MIRT1551642	hsa-miR-4528	CLIP-seq
MIRT2051505	hsa-miR-4789-5p	CLIP-seq
MIRT2051506	hsa-miR-485-3p	CLIP-seq
MIRT1177990	hsa-miR-499a-5p	CLIP-seq
MIRT1177991	hsa-miR-507	CLIP-seq
MIRT2051507	hsa-miR-516a-3p	CLIP-seq
MIRT1177993	hsa-miR-548p	CLIP-seq
MIRT1177995	hsa-miR-557	CLIP-seq
MIRT2051508	hsa-miR-590-3p	CLIP-seq
MIRT2051509	hsa-miR-600	CLIP-seq
MIRT1177998	hsa-miR-635	CLIP-seq
MIRT2051494	hsa-miR-101	CLIP-seq
MIRT2280556	hsa-miR-1228	CLIP-seq
MIRT1177957	hsa-miR-129-5p	CLIP-seq
MIRT2280557	hsa-miR-144	CLIP-seq
MIRT1177962	hsa-miR-3143	CLIP-seq
MIRT2280558	hsa-miR-3201	CLIP-seq
MIRT2051497	hsa-miR-338-3p	CLIP-seq
MIRT2051498	hsa-miR-338-5p	CLIP-seq
MIRT1177967	hsa-miR-3614-5p	CLIP-seq
MIRT1177969	hsa-miR-3662	CLIP-seq
MIRT2280559	hsa-miR-3691-3p	CLIP-seq
MIRT2051503	hsa-miR-4310	CLIP-seq
MIRT1177976	hsa-miR-4325	CLIP-seq
MIRT1177977	hsa-miR-4328	CLIP-seq
MIRT2051504	hsa-miR-4435	CLIP-seq
MIRT1177979	hsa-miR-450b-5p	CLIP-seq
MIRT1551642	hsa-miR-4528	CLIP-seq
MIRT1177983	hsa-miR-4699-3p	CLIP-seq
MIRT2051505	hsa-miR-4789-5p	CLIP-seq
MIRT2280560	hsa-miR-4791	CLIP-seq
MIRT1177987	hsa-miR-4803	CLIP-seq
MIRT1177990	hsa-miR-499a-5p	CLIP-seq
MIRT1177991	hsa-miR-507	CLIP-seq
MIRT2280561	hsa-miR-548g	CLIP-seq
MIRT1177993	hsa-miR-548p	CLIP-seq
MIRT1177995	hsa-miR-557	CLIP-seq
MIRT2280562	hsa-miR-567	CLIP-seq
MIRT2280563	hsa-miR-570	CLIP-seq
MIRT1177996	hsa-miR-582-5p	CLIP-seq
MIRT2051508	hsa-miR-590-3p	CLIP-seq
MIRT2051509	hsa-miR-600	CLIP-seq
MIRT1177998	hsa-miR-635	CLIP-seq
MIRT2454961	hsa-miR-155	CLIP-seq
MIRT2454962	hsa-miR-3163	CLIP-seq
MIRT2454963	hsa-miR-4795-3p	CLIP-seq
MIRT2051494	hsa-miR-101	CLIP-seq
MIRT2578995	hsa-miR-1226	CLIP-seq
MIRT2578996	hsa-miR-124	CLIP-seq
MIRT2578997	hsa-miR-1258	CLIP-seq
MIRT2578998	hsa-miR-1264	CLIP-seq
MIRT2578999	hsa-miR-1277	CLIP-seq
MIRT2579000	hsa-miR-1283	CLIP-seq
MIRT2579001	hsa-miR-141	CLIP-seq
MIRT2280557	hsa-miR-144	CLIP-seq
MIRT2454961	hsa-miR-155	CLIP-seq
MIRT2579002	hsa-miR-200a	CLIP-seq
MIRT1177961	hsa-miR-24	CLIP-seq
MIRT2579003	hsa-miR-300	CLIP-seq
MIRT2579004	hsa-miR-3140-5p	CLIP-seq
MIRT1177964	hsa-miR-3162-3p	CLIP-seq
MIRT2579005	hsa-miR-3162-5p	CLIP-seq
MIRT2579006	hsa-miR-3183	CLIP-seq
MIRT1177965	hsa-miR-335	CLIP-seq
MIRT2051498	hsa-miR-338-5p	CLIP-seq
MIRT2579007	hsa-miR-34b	CLIP-seq
MIRT2579008	hsa-miR-3619-3p	CLIP-seq
MIRT1177969	hsa-miR-3662	CLIP-seq
MIRT2579009	hsa-miR-3682-5p	CLIP-seq
MIRT2579010	hsa-miR-3714	CLIP-seq
MIRT1177970	hsa-miR-371-5p	CLIP-seq
MIRT2579011	hsa-miR-371b-5p	CLIP-seq
MIRT1177971	hsa-miR-374c	CLIP-seq
MIRT2579012	hsa-miR-381	CLIP-seq
MIRT2579013	hsa-miR-3910	CLIP-seq
MIRT2051502	hsa-miR-410	CLIP-seq
MIRT2579014	hsa-miR-4268	CLIP-seq
MIRT2579015	hsa-miR-4277	CLIP-seq
MIRT1177974	hsa-miR-4284	CLIP-seq
MIRT1177975	hsa-miR-4313	CLIP-seq
MIRT2579016	hsa-miR-4427	CLIP-seq
MIRT2579017	hsa-miR-4448	CLIP-seq
MIRT1177978	hsa-miR-4477a	CLIP-seq
MIRT2579018	hsa-miR-4666-3p	CLIP-seq
MIRT1177982	hsa-miR-4696	CLIP-seq
MIRT2579019	hsa-miR-4723-3p	CLIP-seq
MIRT2579020	hsa-miR-4733-3p	CLIP-seq
MIRT2579021	hsa-miR-4768-3p	CLIP-seq
MIRT2579022	hsa-miR-4776-5p	CLIP-seq
MIRT2579023	hsa-miR-4793-5p	CLIP-seq
MIRT1177988	hsa-miR-499-3p	CLIP-seq
MIRT1177989	hsa-miR-499a-3p	CLIP-seq
MIRT1177990	hsa-miR-499a-5p	CLIP-seq
MIRT2579024	hsa-miR-500a	CLIP-seq
MIRT2579025	hsa-miR-506	CLIP-seq
MIRT2579026	hsa-miR-548aa	CLIP-seq
MIRT2579027	hsa-miR-550b	CLIP-seq
MIRT2280562	hsa-miR-567	CLIP-seq
MIRT1177999	hsa-miR-655	CLIP-seq
MIRT2579028	hsa-miR-665	CLIP-seq
MIRT1551644	hsa-miR-875-3p	CLIP-seq
MIRT2051494	hsa-miR-101	CLIP-seq
MIRT2578995	hsa-miR-1226	CLIP-seq
MIRT2578996	hsa-miR-124	CLIP-seq
MIRT2578997	hsa-miR-1258	CLIP-seq
MIRT2578998	hsa-miR-1264	CLIP-seq
MIRT2578999	hsa-miR-1277	CLIP-seq
MIRT2579000	hsa-miR-1283	CLIP-seq
MIRT2280557	hsa-miR-144	CLIP-seq
MIRT2454961	hsa-miR-155	CLIP-seq
MIRT1177961	hsa-miR-24	CLIP-seq
MIRT2579004	hsa-miR-3140-5p	CLIP-seq
MIRT1177964	hsa-miR-3162-3p	CLIP-seq
MIRT2579005	hsa-miR-3162-5p	CLIP-seq
MIRT2579006	hsa-miR-3183	CLIP-seq
MIRT1177965	hsa-miR-335	CLIP-seq
MIRT2051498	hsa-miR-338-5p	CLIP-seq
MIRT2579007	hsa-miR-34b	CLIP-seq
MIRT2579008	hsa-miR-3619-3p	CLIP-seq
MIRT1177969	hsa-miR-3662	CLIP-seq
MIRT2579009	hsa-miR-3682-5p	CLIP-seq
MIRT2579010	hsa-miR-3714	CLIP-seq
MIRT1177970	hsa-miR-371-5p	CLIP-seq
MIRT2579011	hsa-miR-371b-5p	CLIP-seq
MIRT1177971	hsa-miR-374c	CLIP-seq
MIRT2579013	hsa-miR-3910	CLIP-seq
MIRT2051502	hsa-miR-410	CLIP-seq
MIRT2579014	hsa-miR-4268	CLIP-seq
MIRT1177974	hsa-miR-4284	CLIP-seq
MIRT1177975	hsa-miR-4313	CLIP-seq
MIRT2579016	hsa-miR-4427	CLIP-seq
MIRT2579017	hsa-miR-4448	CLIP-seq
MIRT1177978	hsa-miR-4477a	CLIP-seq
MIRT1177982	hsa-miR-4696	CLIP-seq
MIRT2579019	hsa-miR-4723-3p	CLIP-seq
MIRT2579020	hsa-miR-4733-3p	CLIP-seq
MIRT2579022	hsa-miR-4776-5p	CLIP-seq
MIRT2579023	hsa-miR-4793-5p	CLIP-seq
MIRT1177988	hsa-miR-499-3p	CLIP-seq
MIRT1177989	hsa-miR-499a-3p	CLIP-seq
MIRT1177990	hsa-miR-499a-5p	CLIP-seq
MIRT2579024	hsa-miR-500a	CLIP-seq
MIRT2579025	hsa-miR-506	CLIP-seq
MIRT2579027	hsa-miR-550b	CLIP-seq
MIRT2280562	hsa-miR-567	CLIP-seq
MIRT1177999	hsa-miR-655	CLIP-seq

Show/Hide all (40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0002761	Process	Regulation of myeloid leukocyte differentiation	IEA
GO:0002829	Process	Negative regulation of type 2 immune response	IEA
GO:0005515	Function	Protein binding	IPI	18776082, 19706893, 25631046, 26363003, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005938	Component	Cell cortex	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IBA
GO:0006879	Process	Intracellular iron ion homeostasis	IMP	18776082
GO:0007034	Process	Vacuolar transport	IEA
GO:0010008	Component	Endosome membrane	IEA
GO:0010629	Process	Negative regulation of gene expression	IMP	18776082
GO:0016020	Component	Membrane	IEA
GO:0030001	Process	Metal ion transport	IEA
GO:0030163	Process	Protein catabolic process	IEA
GO:0030425	Component	Dendrite	IEA
GO:0031398	Process	Positive regulation of protein ubiquitination	IBA
GO:0031398	Process	Positive regulation of protein ubiquitination	IDA	25631046
GO:0031398	Process	Positive regulation of protein ubiquitination	IMP	18776082
GO:0032410	Process	Negative regulation of transporter activity	IMP	18776082
GO:0032713	Process	Negative regulation of interleukin-4 production	IEA
GO:0035739	Process	CD4-positive, alpha-beta T cell proliferation	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	HMP	12761501
GO:0045202	Component	Synapse	IEA
GO:0045619	Process	Regulation of lymphocyte differentiation	IEA
GO:0045732	Process	Positive regulation of protein catabolic process	IEA
GO:0048294	Process	Negative regulation of isotype switching to IgE isotypes	IEA
GO:0048302	Process	Regulation of isotype switching to IgG isotypes	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	18776082
GO:0050699	Function	WW domain binding	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0051224	Process	Negative regulation of protein transport	IMP	18776082
GO:2000562	Process	Negative regulation of CD4-positive, alpha-beta T cell proliferation	IEA

MIM	HGNC	e!Ensembl
612050	17592	ENSG00000131507

Q9BT67

Protein name

NEDD4 family-interacting protein 1 (Breast cancer-associated protein SGA-1M) (NEDD4 WW domain-binding protein 5) (Putative MAPK-activating protein PM13) (Putative NF-kappa-B-activating protein 164) (Putative NFKB and MAPK-activating protein)

Protein function

Activates HECT domain-containing E3 ubiquitin-protein ligases, including NEDD4 and ITCH, and consequently modulates the stability of their targets. As a result, controls many cellular processes. Prevents chronic T-helper cell-mediated inflammati

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10176	DUF2370	54 → 173	Protein of unknown function (DUF2370)	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Higher levels are detected in cerebellum, pituitary, thalamus, kidney, liver, testis, salivary glands and placenta. Also expressed in fetal brain, kidney and lung. {ECO:0000269|PubMed:11748237}.

Sequence

MALALAALAAVEPACGSRYQQLQNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESG
FPKPPSYNVATTLPSYDEAERTKAEATIPLVPGRDEDFVGRDDFDDADQLRIGNDGIFML
TFFMAFLFNWIGFFLSFCLTTSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDGQYWL
WWVFLVLGFLLFLRGFINYAKVRKMPETFSNLPRTRVLFIY

Sequence length

221

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (22)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY LIVER CIRRHOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORNEAL ASTIGMATISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CIRRHOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TESTICULAR CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TESTICULAR GERM CELL TUMOR	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (18)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	21907864		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	21907864, 25997986	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	GWASCAT_DG	27182965, 29273806, 30929738		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Childhood asthma	Asthma	GWASCAT_DG	30929738, 31036433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	GWASCAT_DG	26974007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28051111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	26192919, 26974007, 28067908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	30021156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	23128233, 26192919, 28067908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASDB_DG	23128233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31218102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASCAT_DG	24076602		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	BEFREE	24475238, 25467637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	GWASCAT_DG	26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Senile Plaques	Senile Plaques	BEFREE	29937728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	26192919, 26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Uveal melanoma	Pubtator	29333944	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

NDFIP1 (Nedd4 family interacting protein 1)