LY6G5C (lymphocyte antigen 6 family member G5C)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 80741
Gene name Lymphocyte antigen 6 family member G5C
Gene symbol LY6G5C
Synonyms (NCBI Gene)
C6orf20G5CLY6G5CALY6G5CBNG33
Chromosome 6
Chromosome location 6p21.33
Summary LY6G5C belongs to a cluster of leukocyte antigen-6 (LY6) genes located in the major histocompatibility complex (MHC) class III region on chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. Most
miRNA miRNA information provided by mirtarbase database.
11
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (11)
miRTarBase ID miRNA Experiments Reference
MIRT2265230 hsa-miR-3125 CLIP-seq
MIRT2265231 hsa-miR-3916 CLIP-seq
MIRT2265232 hsa-miR-4496 CLIP-seq
MIRT2265233 hsa-miR-4505 CLIP-seq
MIRT2390401 hsa-miR-1321 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (8)
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
GO:0009897 Component External side of plasma membrane IBA
GO:0009897 Component External side of plasma membrane IDA 17008713
GO:0009897 Component External side of plasma membrane IEA
GO:0032991 Component Protein-containing complex IDA 17008713
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
610434 13932 ENSG00000204428
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5SRR4
Protein name Lymphocyte antigen 6 complex locus protein G5c
Protein function May have a role in hematopoietic cell differentiation.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Detected in T-cell lines and fetal and adult lung. {ECO:0000269|PubMed:12079290}.
Sequence 
MRFMAGPAGSQSLGPLCFHSSPQALYTVLLIVLVMMSLVFGKFVPVNWEPPQPLPFPKYL
RCYRCLLETKELGCLLGSDICLTPAGSSCITLHKKNSSGSDVMVSDCRSKEQMSDCSNTR
TSPVSGFWIFSQYCFLDFCNDPQNRGLYTP
Sequence length 150
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (2)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
SARCOIDOSIS — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (2)
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Diabetes Mellitus, Insulin-Dependent Diabetes Mellitus GWASDB_DG 17632545
★★★★★
★☆☆☆☆
Found in Text Mining only
Rheumatoid Arthritis Rheumatoid arthritis GWASDB_DG 17804836, 19503088
★★★★★
★☆☆☆☆
Found in Text Mining only