Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	80740
Gene name	Lymphocyte antigen 6 family member G6C
Gene symbol	LY6G6C
Synonyms (NCBI Gene)	C6orf24G6cNG24
Chromosome	6
Chromosome location	6p21.33
Summary	LY6G6C belongs to a cluster of leukocyte antigen-6 (LY6) genes located in the major histocompatibility complex (MHC) class III region on chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. Most

Show/Hide all (48)

miRTarBase ID	miRNA	Experiments
MIRT1122851	hsa-miR-1294	CLIP-seq
MIRT1122852	hsa-miR-1297	CLIP-seq
MIRT1122853	hsa-miR-1470	CLIP-seq
MIRT1122854	hsa-miR-1972	CLIP-seq
MIRT1122855	hsa-miR-2110	CLIP-seq
MIRT1122856	hsa-miR-26a	CLIP-seq
MIRT1122857	hsa-miR-26b	CLIP-seq
MIRT1122858	hsa-miR-3144-5p	CLIP-seq
MIRT1122859	hsa-miR-3150a-3p	CLIP-seq
MIRT1122860	hsa-miR-3175	CLIP-seq
MIRT1122861	hsa-miR-3189-5p	CLIP-seq
MIRT1122862	hsa-miR-3191	CLIP-seq
MIRT1122863	hsa-miR-3614-3p	CLIP-seq
MIRT1122864	hsa-miR-3675-5p	CLIP-seq
MIRT1122865	hsa-miR-3688-3p	CLIP-seq
MIRT1122866	hsa-miR-3978	CLIP-seq
MIRT1122867	hsa-miR-4260	CLIP-seq
MIRT1122868	hsa-miR-4265	CLIP-seq
MIRT1122869	hsa-miR-4296	CLIP-seq
MIRT1122870	hsa-miR-4300	CLIP-seq
MIRT1122871	hsa-miR-4322	CLIP-seq
MIRT1122872	hsa-miR-4323	CLIP-seq
MIRT1122873	hsa-miR-4420	CLIP-seq
MIRT1122874	hsa-miR-4465	CLIP-seq
MIRT1122875	hsa-miR-4648	CLIP-seq
MIRT1122876	hsa-miR-4650-5p	CLIP-seq
MIRT1122877	hsa-miR-4652-5p	CLIP-seq
MIRT1122878	hsa-miR-4654	CLIP-seq
MIRT1122879	hsa-miR-4667-3p	CLIP-seq
MIRT1122880	hsa-miR-4667-5p	CLIP-seq
MIRT1122881	hsa-miR-4694-3p	CLIP-seq
MIRT1122882	hsa-miR-4698	CLIP-seq
MIRT1122883	hsa-miR-4700-5p	CLIP-seq
MIRT1122884	hsa-miR-4733-5p	CLIP-seq
MIRT1122885	hsa-miR-4769-5p	CLIP-seq
MIRT1122886	hsa-miR-496	CLIP-seq
MIRT1122887	hsa-miR-583	CLIP-seq
MIRT1122888	hsa-miR-920	CLIP-seq
MIRT1122889	hsa-miR-922	CLIP-seq
MIRT1122890	hsa-miR-939	CLIP-seq
MIRT1122852	hsa-miR-1297	CLIP-seq
MIRT1122853	hsa-miR-1470	CLIP-seq
MIRT1122856	hsa-miR-26a	CLIP-seq
MIRT1122857	hsa-miR-26b	CLIP-seq
MIRT1122874	hsa-miR-4465	CLIP-seq
MIRT1122879	hsa-miR-4667-3p	CLIP-seq
MIRT1122889	hsa-miR-922	CLIP-seq
MIRT1122851	hsa-miR-1294	CLIP-seq

Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IDA	17008713
GO:0016020	Component	Membrane	IEA
GO:0032991	Component	Protein-containing complex	IBA
GO:0032991	Component	Protein-containing complex	IDA	17008713
GO:0042802	Function	Identical protein binding	IDA	17008713
GO:0098552	Component	Side of membrane	IEA

MIM	HGNC	e!Ensembl
610435	13936	ENSG00000204421

O95867

Protein name

Lymphocyte antigen 6 complex locus protein G6c

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Highly expressed at the leading edges of cells, on filopodia. {ECO:0000269|PubMed:17008713}.

Sequence

MKALMLLTLSVLLCWVSADIRCHSCYKVPVLGCVDRQSCRLEPGQQCLTTHAYLGKMWVF
SNLRCGTPEEPCQEAFNQTNRKLGLTYNTTCCNKDNCNSAGPRPTPALGLVFLTSLAGLG
LWLLH

Sequence length

125

Interactions

View interactions

	Reactome
			Post-translational modification: synthesis of GPI-anchored proteins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35395711	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	31556830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	33725943	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	17632545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	GWASDB_DG	24149102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASDB_DG	24871463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucositis	Mucositis	Pubtator	29338018	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10902805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	21156761		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma Kaposi	Sarcoma	Pubtator	25008864	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

LY6G6C (lymphocyte antigen 6 family member G6C)