Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8074
Gene name	Fibroblast growth factor 23
Gene symbol	FGF23
Synonyms (NCBI Gene)	ADHRFGFNHFTC2HPDR2HYPFPHPTC
Chromosome	12
Chromosome location	12p13.32
Summary	This gene encodes a member of the fibroblast growth factor family of proteins, which possess broad mitogenic and cell survival activities and are involved in a variety of biological processes. The product of this gene regulates phosphate homeostasis and t

Show/Hide all (11)

SNP ID	Visualize variation	Clinical significance	Consequence
rs28937882	G>A,T	Likely-pathogenic, pathogenic	Missense variant, synonymous variant, coding sequence variant
rs104894342	T>C	Pathogenic, likely-pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs104894343	A>G	Pathogenic	Coding sequence variant, missense variant
rs104894344	G>A	Pathogenic	Coding sequence variant, missense variant
rs104894347	C>T	Pathogenic	Coding sequence variant, missense variant
rs193922701	C>G	Likely-pathogenic	Missense variant, coding sequence variant
rs193922702	C>T	Pathogenic	Missense variant, coding sequence variant
rs863224872	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs1064795205	C>T	Likely-pathogenic	Stop gained, coding sequence variant
rs1220533001	C>A,G	Pathogenic	Missense variant, coding sequence variant
rs1555096583	A>G	Pathogenic	Missense variant, coding sequence variant

Show/Hide all (62)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017013	hsa-miR-335-5p	Microarray	18185580
MIRT029016	hsa-miR-26b-5p	Microarray	19088304
MIRT995668	hsa-miR-1273d	CLIP-seq
MIRT995669	hsa-miR-1276	CLIP-seq
MIRT995670	hsa-miR-1286	CLIP-seq
MIRT995671	hsa-miR-1321	CLIP-seq
MIRT995672	hsa-miR-140-3p	CLIP-seq
MIRT995673	hsa-miR-186	CLIP-seq
MIRT995674	hsa-miR-1910	CLIP-seq
MIRT995675	hsa-miR-1912	CLIP-seq
MIRT995676	hsa-miR-3119	CLIP-seq
MIRT995677	hsa-miR-3133	CLIP-seq
MIRT995678	hsa-miR-3148	CLIP-seq
MIRT995679	hsa-miR-335	CLIP-seq
MIRT995680	hsa-miR-3936	CLIP-seq
MIRT995681	hsa-miR-4293	CLIP-seq
MIRT995682	hsa-miR-4311	CLIP-seq
MIRT995683	hsa-miR-4419a	CLIP-seq
MIRT995684	hsa-miR-4510	CLIP-seq
MIRT995685	hsa-miR-455-3p	CLIP-seq
MIRT995686	hsa-miR-4659a-5p	CLIP-seq
MIRT995687	hsa-miR-4659b-5p	CLIP-seq
MIRT995688	hsa-miR-4722-5p	CLIP-seq
MIRT995689	hsa-miR-4729	CLIP-seq
MIRT995690	hsa-miR-4739	CLIP-seq
MIRT995691	hsa-miR-4756-5p	CLIP-seq
MIRT995692	hsa-miR-4776-3p	CLIP-seq
MIRT995693	hsa-miR-4786-5p	CLIP-seq
MIRT995694	hsa-miR-583	CLIP-seq
MIRT995695	hsa-miR-591	CLIP-seq
MIRT995668	hsa-miR-1273d	CLIP-seq
MIRT995675	hsa-miR-1912	CLIP-seq
MIRT1995258	hsa-miR-2278	CLIP-seq
MIRT1995259	hsa-miR-3127-3p	CLIP-seq
MIRT1995260	hsa-miR-3161	CLIP-seq
MIRT1995261	hsa-miR-323b-3p	CLIP-seq
MIRT1995262	hsa-miR-34a	CLIP-seq
MIRT1995263	hsa-miR-34c-5p	CLIP-seq
MIRT1995264	hsa-miR-4274	CLIP-seq
MIRT1995265	hsa-miR-449a	CLIP-seq
MIRT1995266	hsa-miR-449b	CLIP-seq
MIRT1995267	hsa-miR-4501	CLIP-seq
MIRT1995268	hsa-miR-539	CLIP-seq
MIRT1995269	hsa-miR-548a-3p	CLIP-seq
MIRT1995270	hsa-miR-548e	CLIP-seq
MIRT1995271	hsa-miR-548f	CLIP-seq
MIRT2229365	hsa-miR-1290	CLIP-seq
MIRT2229366	hsa-miR-3152-5p	CLIP-seq
MIRT2229367	hsa-miR-3167	CLIP-seq
MIRT2229368	hsa-miR-326	CLIP-seq
MIRT2229369	hsa-miR-330-5p	CLIP-seq
MIRT2229370	hsa-miR-4297	CLIP-seq
MIRT2229371	hsa-miR-4700-3p	CLIP-seq
MIRT2229372	hsa-miR-4774-3p	CLIP-seq
MIRT2229373	hsa-miR-4782-5p	CLIP-seq
MIRT2229374	hsa-miR-876-5p	CLIP-seq
MIRT2229375	hsa-miR-942	CLIP-seq
MIRT1995260	hsa-miR-3161	CLIP-seq
MIRT1995261	hsa-miR-323b-3p	CLIP-seq
MIRT1995269	hsa-miR-548a-3p	CLIP-seq
MIRT1995270	hsa-miR-548e	CLIP-seq
MIRT1995271	hsa-miR-548f	CLIP-seq

Show/Hide all (44)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IEA
GO:0005104	Function	Fibroblast growth factor receptor binding	IEA
GO:0005105	Function	Type 1 fibroblast growth factor receptor binding	IBA
GO:0005105	Function	Type 1 fibroblast growth factor receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	17086194, 19966287, 35512704
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	16638743
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005796	Component	Golgi lumen	TAS
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IBA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IEA
GO:0010966	Process	Regulation of phosphate transport	IDA	11409890
GO:0010980	Process	Positive regulation of vitamin D 24-hydroxylase activity	IDA	15040831
GO:0022008	Process	Neurogenesis	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0030334	Process	Regulation of cell migration	IBA
GO:0030500	Process	Regulation of bone mineralization	IEA
GO:0030502	Process	Negative regulation of bone mineralization	IDA	18282132
GO:0030643	Process	Intracellular phosphate ion homeostasis	IEA
GO:0032026	Process	Response to magnesium ion	IEA
GO:0042359	Process	Vitamin D metabolic process	IEA
GO:0042369	Process	Vitamin D catabolic process	IDA	15040831
GO:0043410	Process	Positive regulation of MAPK cascade	IBA
GO:0044320	Process	Cellular response to leptin stimulus	IEA
GO:0045668	Process	Negative regulation of osteoblast differentiation	IDA	18282132
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0046888	Process	Negative regulation of hormone secretion	IEA
GO:0046888	Process	Negative regulation of hormone secretion	ISS
GO:0055062	Process	Phosphate ion homeostasis	IMP	11062477
GO:0055074	Process	Calcium ion homeostasis	IEA
GO:0070371	Process	ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0071305	Process	Cellular response to vitamin D	IEA
GO:0071354	Process	Cellular response to interleukin-6	IEA
GO:0071374	Process	Cellular response to parathyroid hormone stimulus	IEA
GO:0090080	Process	Positive regulation of MAPKKK cascade by fibroblast growth factor receptor signaling pathway	IEA
GO:1904383	Process	Response to sodium phosphate	IEA

MIM	HGNC	e!Ensembl
605380	3680	ENSG00000118972

Q9GZV9

Protein name

Fibroblast growth factor 23 (FGF-23) (Phosphatonin) (Tumor-derived hypophosphatemia-inducing factor) [Cleaved into: Fibroblast growth factor 23 N-terminal peptide; Fibroblast growth factor 23 C-terminal peptide]

Protein function

Regulator of phosphate homeostasis (PubMed:11062477). Inhibits renal tubular phosphate transport by reducing SLC34A1 levels (PubMed:11409890). Up-regulates EGR1 expression in the presence of KL (By similarity). Acts directly on the parathyroid t

PDB

2P39 , 5W21 , 6S22 , 7YSH , 7YSU , 7YSW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00167	FGF	39 → 150	Fibroblast growth factor	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in osteogenic cells particularly during phases of active bone remodeling. In adult trabecular bone, expressed in osteocytes and flattened bone-lining cells (inactive osteoblasts). {ECO:0000269|PubMed:12952917}.

Sequence

MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGH
VDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTL
ENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRS
AEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTG
PEGCRPFAKFI

Sequence length

251

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Ras signaling pathway Rap1 signaling pathway Calcium signaling pathway PI3K-Akt signaling pathway Regulation of actin cytoskeleton Parathyroid hormone synthesis, secretion and action Pathways in cancer Melanoma Breast cancer Gastric cancer		PI3K Cascade PIP3 activates AKT signaling Signaling by activated point mutants of FGFR1 Signaling by activated point mutants of FGFR3 FGFR4 ligand binding and activation FGFR3c ligand binding and activation FGFR1c ligand binding and activation FGFR1c and Klotho ligand binding and activation FGFR2c ligand binding and activation FGFR3 mutant receptor activation Activated point mutants of FGFR2 Constitutive Signaling by Aberrant PI3K in Cancer Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) Phospholipase C-mediated cascade: FGFR1 Phospholipase C-mediated cascade; FGFR2 Phospholipase C-mediated cascade; FGFR3 Phospholipase C-mediated cascade; FGFR4 Downstream signaling of activated FGFR1 SHC-mediated cascade:FGFR1 PI-3K cascade:FGFR1 FRS-mediated FGFR1 signaling PI-3K cascade:FGFR2 SHC-mediated cascade:FGFR2 FRS-mediated FGFR2 signaling SHC-mediated cascade:FGFR3 FRS-mediated FGFR3 signaling PI-3K cascade:FGFR3 FRS-mediated FGFR4 signaling SHC-mediated cascade:FGFR4 PI-3K cascade:FGFR4 Negative regulation of FGFR1 signaling Negative regulation of FGFR2 signaling Negative regulation of FGFR3 signaling Negative regulation of FGFR4 signaling Signaling by FGFR2 in disease Signaling by FGFR1 in disease FGFRL1 modulation of FGFR1 signaling RAF/MAP kinase cascade PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling Signaling by FGFR3 point mutants in cancer Post-translational protein phosphorylation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (6)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Autosomal dominant hypophosphatemic rickets	Pathogenic; Likely pathogenic	rs104894347, rs28937882, rs2497236074, rs193922701, rs193922702	RCV000005328 RCV000005329 RCV003476889 RCV000029797 RCV000029798	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Familial hyperphosphatemic tumoral calcinosis/hyperphosphatemic hyperostosis syndrome	Likely pathogenic	rs863224872	RCV000197637	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hypophosphatemic rickets	Pathogenic	rs193922702	RCV001843462	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Short stature	Pathogenic	rs193922702	RCV005245482	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Tumoral calcinosis, hyperphosphatemic, familial, 1	Likely pathogenic; Pathogenic	rs1555096583, rs1220533001	RCV000513167 RCV000513584	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Tumoral calcinosis, hyperphosphatemic, familial, 2	Pathogenic; Likely pathogenic	rs104894343, rs104894344, rs1555096583, rs193922702	RCV000005331 RCV000005332 RCV001796086 RCV002482917	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CALCINOSIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FGF23-related disorder	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERCALCEMIC TUMORAL CALCINOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOPHOSPHATEMIC RICKETS, AUTOSOMAL DOMINANT	—	CTD, HPO CTD, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypophosphatemic Rickets, Dominant	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TUMORAL CALCINOSIS, HYPERPHOSPHATEMIC, FAMILIAL	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (326)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	29710336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	23393166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Rickets	Rickets	BEFREE	12519781, 12952927, 16337659, 17033621, 19581284, 20841428, 21745613, 22396161, 23174215, 24006476, 25089825, 25165185, 26721590, 27754732, 27929669 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Rickets	Rickets	LHGDN	12590648, 15930999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Rickets	Rickets	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Amelogenesis Imperfecta	Amelogenesis imperfecta	Pubtator	36351670	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amelogenesis imperfecta local hypoplastic form	Amelogenesis imperfecta	Pubtator	36351670	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	24509850, 28475601, 28784656, 29073196, 29740119, 30353318, 30664681, 31145704, 31278194, 31461904, 31519999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	29400142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	26558428	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic valve calcification	Aortic valve calcification	BEFREE	31048102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arrhythmias Cardiac	Cardiac arrhythmias	Pubtator	35008591	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	25237047, 25730009, 27704252, 28017526, 29113983, 30064143, 31025926, 31048102, 31420749, 31542779, 31773386, 31801144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	37627287	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia, Spinocerebellar	Spinocerebellar Ataxia	BEFREE	19621416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	25237047, 25730009, 27704252, 28017526, 29113983, 30064143, 31048102, 31420749, 31542779, 31773386, 31801144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	28619026, 31542779	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	25237047, 27609943, 30138898, 30615112, 30953354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	34798808	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal dominant hypophosphatemic rickets	Hypophosphatemic Rickets	BEFREE	11062477, 11157998, 11344269, 11409890, 11551862, 11595624, 11737582, 12111239, 12519781, 12711740, 12791601, 12952917, 14988389, 15579309, 15687325 View all (26 more)		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Autosomal dominant hypophosphatemic rickets	Hypophosphatemic Rickets	GENOMICS_ENGLAND_DG	11062477, 15590700		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Autosomal dominant hypophosphatemic rickets	Hypophosphatemic Rickets	ORPHANET_DG	11062477, 19655082		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Autosomal dominant hypophosphatemic rickets	Hypophosphatemic Rickets	UNIPROT_DG	11062477, 11409890, 16638743		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Autosomal dominant hypophosphatemic rickets	Hypophosphatemic Rickets	Orphanet			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Autosomal dominant hypophosphatemic rickets	Hypophosphatemic Rickets	CTD_human_DG			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Autosomal dominant hypophosphatemic rickets	Hypophosphatemic Rickets	CLINVAR_DG			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Autosomal recessive hypophosphatemic vitamin D refractory rickets	Hypophosphatemic Vitamin D Refractory Rickets, X-Linked	BEFREE	19007919, 20499351, 21745613, 23403405, 25620749, 30827034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	29532101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	24053368		★★★★★ ★☆☆☆☆ Found in Text Mining only
BESTROPHINOPATHY, AUTOSOMAL RECESSIVE	Bestrophinopathy	BEFREE	27220755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	21750158, 27838783, 28044233, 28131132, 28401422, 28594289, 29050900, 29558205, 29679282, 30109232, 30217807, 30302919, 30585865, 30791553, 31107286, 31420749 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	24006476, 28594289, 32236867	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	31354894, 31648693, 37192015, 40133996	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases, Developmental	Bone Disease	BEFREE	24243633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	25319834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	29846497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	18682534, 18982401, 23325605, 25378588, 27164190, 29548779, 31542779, 33685073	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	37242266, 38148081	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	30281149	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	30836094	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	37249797	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	29849175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	36049813, 37749114	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular abnormalities	Pubtator	24168888	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	22406119, 23389416, 24509850, 24867675, 25237047, 25498378, 27704252, 28006765, 28017526, 28027796, 28028134, 28087977, 28212898, 28329057, 28535521 View all (33 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	26681731, 30669147, 33783172, 34387090, 36719157, 37627287	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	32077150	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	20196777, 21406294, 36799502	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	29846497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral Microangiopathy	BEFREE	30830941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29516098, 29710336, 29764921, 30077605, 31659218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	30278796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	28445152	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondroma	Chondroma	BEFREE	31273315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondromyxoid fibroma	Chondromyxoid Fibroma	BEFREE	26956379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	31423921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 2	Kidney Disease	BEFREE	31553973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 3	Kidney Disease	BEFREE	28838895, 28971600, 31584563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	16481873, 25766835, 28743129, 29621752, 30138898, 30329020, 30428848, 30465136, 30537427, 30968207, 31420749, 31422393, 31668375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	16884396, 17635819, 17976082, 19626341, 20150940, 21496980, 21610497, 21750158, 21778753, 21985788, 22031097, 22100522, 22406119, 22480598, 22660551 View all (169 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	29748308, 30236113, 31075857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Class III malocclusion	Malocclusion	BEFREE	26059428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	30115946	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	23393166	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24574808, 34469519	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Disorders of Glycosylation	Congenital disorder of glycosylation	Pubtator	17129170	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	24168888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital melanocytic nevus	Congenital Melanocytic Nevus	BEFREE	24006476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Nephrogenic Diabetes Insipidus	Nephrogenic Diabetes Insipidus	BEFREE	7913579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	27579618, 27682653, 27942882, 28701671, 28924605, 29074091, 29306478, 29309658, 29516098, 29710336, 29764921, 29849175, 29892269, 30062428, 30205090 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29940774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	30852297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	24168888, 35263363	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	33413149, 35546659	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	29516098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary restenosis	Pubtator	33413149	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	29298794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	29085059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic liver disease	Cystic liver disease	BEFREE	29618028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	22393163, 29718273, 31260189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	30830941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	24006476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	22480598, 27039198, 28619026, 28651327, 29113983, 30551370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	22480598, 27039198, 27622867, 28619026, 28651327, 29113983, 29147074, 30228288, 30551370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	36907780	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	28619026, 29113983, 36907780	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	27832316, 28451950, 28619026, 29113983, 29574933, 29698460, 30228288, 30718148, 30943313, 30987161, 31488569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	29548779	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic Foot	BEFREE	30987161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	23302066	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	25324042	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29843712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	32993645	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	40661832	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine System Diseases	BEFREE	29669167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	33413149	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	29336609, 31058117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	29336609, 36907780	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	Pubtator	12952917, 22247037, 38174586	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial hypercholesterolemia - homozygous	Hypercholesterolemia	BEFREE	29550495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial hyperphosphatemic tumoral calcinosis/Hyperphosphatemic hyperostosis syndrome	Hyperphosphatemic Tumoral Calcinosis	Orphanet			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Familial Hypophosphatemic Rickets	Hypophosphatemic Rickets	LHGDN	11062477, 11737582, 11805436, 16055933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Hypophosphatemic Rickets	Hypophosphatemic Rickets	BEFREE	12111239, 14733920, 15590700, 15930998, 16055933, 18046499, 19581284, 19621416, 19808223, 20137772, 21050253, 21404002, 21745613, 21968816, 22075221 View all (30 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Hypophosphatemic Rickets	Hypophosphatemic rickets	Pubtator	12711740, 20157195, 21597229, 26135520, 27840894, 29947083, 30075510, 30352126, 30772600, 31151476, 33783172, 34333162, 35654784, 36049757, 36051396 View all (7 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial paroxysmal dystonia	Paroxysmal dystonia	Pubtator	33305291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	29284239, 31211688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized Thyroid Hormone Resistance	Thyroid Hormone Resistance	BEFREE	25063548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	28147348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	34333162	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	31384956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	29190002	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	36649363	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	24459137, 30808827, 30934737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	24459137	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	25217649, 35008591, 37749114	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	23740037, 23825530, 30912310, 35008591, 35902130, 37734292	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	27579618, 27682653, 27942882, 28701671, 29074091, 29306478, 29309658, 29516098, 29710336, 29764921, 29892269, 30062428, 30205090, 30256890, 30371180 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	30256890	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure Diastolic	Heart failure	Pubtator	34685778	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure Systolic	Heart failure	Pubtator	35595781	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
hemangiopericytoma	Hemangiopericytoma	BEFREE	19158050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	19890272	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	27848940, 28475601, 28834363, 29429792, 30943476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Humoral hypercalcemia of malignancy (disorder)	Humoral Hypercalcemia Of Malignancy	BEFREE	16884396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	27848940, 28475601, 28834363, 29429792, 30943476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	BEFREE	16775459, 17710231, 24670087, 26047794, 28429545, 29882057, 29977226, 30030744, 31107896, 31527321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	Pubtator	24670087, 36672957	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	33413149	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	29550495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	31211688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	29550495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperostosis	Hyperostosis	BEFREE	17494882, 18322299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism	Hyperparathyroidism	LHGDN	15930999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism	Hyperparathyroidism	BEFREE	27981393, 30302919, 30585865, 30916761, 31107896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism Primary	Hyperparathyroidism	Pubtator	37065752	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism Secondary	Hyperparathyroidism	Pubtator	19890272, 20150940, 20593414, 30669147	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism Secondary	Hyperparathyroidism	Pubtator	21389978	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Primary	Hyperparathyroidism	LHGDN	16381997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Primary	Hyperparathyroidism	BEFREE	28660378, 30916761, 31309599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Secondary	Hyperparathyroidism	BEFREE	17635819, 19890272, 20150940, 23652554, 25446887, 28044233, 28094278, 28429545, 28846459, 28867373, 29038882, 29633272, 30361964, 30411503, 30518682, 30594298 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperphosphatemia (disorder)	Hyperphosphatemia	BEFREE	15579309, 15590700, 16076372, 16775459, 17129170, 17494882, 17710231, 18322299, 19626341, 19808223, 19865099, 19966287, 20358599, 21404002, 21406293 View all (24 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperphosphatemia (disorder)	Hyperphosphatemia	LHGDN	15590700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperphosphatemia (disorder)	Hyperphosphatemia	CTD_human_DG	17710231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperprolactinemia	Hyperprolactinemia	BEFREE	27849387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	34960084, 36907780	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	27039198, 28651327, 28803689, 28993502, 29608553, 29710336, 29712737, 30120363, 30256890, 30329020, 30539338, 30664681, 31698866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	29669167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	22393163, 24620922	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	29025789, 30256890, 35008591	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	20593414, 24620922, 29025789	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	26681731	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	Pubtator	33413149	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoalbuminemia	Hypoalbuminemia	BEFREE	31839746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	BEFREE	28230890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoparathyroidism	Hypoparathyroidism	BEFREE	16884396, 29726397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoparathyroidism	Hypoparathyroidism	LHGDN	17464094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypophosphatemic Rickets	Hypophosphatemic Rickets	ORPHANET_DG	11062477, 19655082		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hypophosphatemic Rickets	Hypophosphatemic Rickets	BEFREE	12111239, 14733920, 15590700, 15930998, 16055933, 19581284, 19621416, 20137772, 21050253, 21404002, 21745613, 21968816, 22075221, 22205508, 22577109 View all (22 more)		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hypophosphatemic Rickets	Hypophosphatemic Rickets	HPO_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hypophosphatemic Rickets Autosomal Dominant	Hypophosphatemic rickets	Pubtator	11737582, 12711740, 12952917, 17227222, 18682534, 21880793, 23174215, 31652009, 38493780	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypophosphatemic Rickets Autosomal Recessive 1	Hypophosphatemic rickets	Pubtator	20499351	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypophosphatemic Rickets Autosomal Recessive 2	Hypophosphatemic rickets	Pubtator	19007919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypophosphatemic Rickets, X-Linked Dominant	Hypophosphatemic Rickets	BEFREE	12111239, 12711740, 12791601, 12874285, 14988389, 15579309, 15940367, 16721588, 17976082, 18046499, 18775977, 19808223, 19952276, 20924400, 2155529 View all (39 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	28594289	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	31354894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31042083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	27812184, 31280282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	33413149	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron deficiency anemia	Iron deficiency anemia	BEFREE	29703633, 30380116, 30518682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	22419710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	LHGDN	14633152, 17567652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	21852584, 24459137, 25060052, 25324042, 26453792, 27005479, 28705885, 36226529, 36907780	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	22031097, 23611556, 27005479, 27427468, 27535551, 27582104, 28456498, 28705885, 28919046, 29147074, 29425318, 29735309, 30514976, 30551370, 30718148 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	24466013, 28183805, 29618028, 30028196, 31422393, 31484825, 31791247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	20593414, 25060052	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	21903990, 25200959, 32077150	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	22660551, 27826644, 28130714, 28706103, 28792535, 28924605, 29288982, 29395333, 29633705, 29861060, 29907141, 30009421, 30022312, 30405444, 30606408 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	11532115, 16481873, 25766835, 28743129, 29621752, 30138898, 30329020, 30428848, 30465136, 30537427, 30968207, 31420749, 31422393, 31668375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	28705885	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	LHGDN	19214027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	21985788, 23389416, 24525546, 24855059, 26437603, 26759036, 27579618, 27704252, 27754732, 27826644, 27942882, 28337344, 28339837, 28401422, 28456498 View all (26 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lesch-Nyhan Syndrome	Lesch-Nyhan Syndrome	BEFREE	22205508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma Myxoid	Liposarcoma	Pubtator	26956379	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma, Myxoid	liposarcoma	BEFREE	26956379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	23825530	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	37627287	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	28063327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	23393166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24053368, 28110703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19444937, 22660551, 23393166, 28362263, 30593185, 30736285, 31643101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	11595624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	24947687	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	28460640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malocclusion	Malocclusion	Pubtator	28257739	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
McCune-Albright Syndrome	McCune-Albright Syndrome	BEFREE	12952917, 16337659, 16369891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningomyelocele	Meningomyelocele	BEFREE	31465293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Bone Disorder	Metabolic Bone Disorder	BEFREE	31354894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28130827, 28901272, 29807981, 30537427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	24638201, 28719612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	Pubtator	35818799	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	24168888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	24168888	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	25944690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	30610965, 31731605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	34745143	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	30134801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	27579618, 27979879, 28329057, 29137111, 29710336, 30852297, 31238301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	30852297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial necrosis	Myocardial necrosis	BEFREE	27979879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myxoid/Round Cell Liposarcoma	Myxoid Liposarcoma	BEFREE	26956379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10620182, 11157998, 12590648, 15542045, 15562028, 17630616, 17976082, 19158050, 21739089, 23393166, 23954138, 25165185, 25319834, 26059403, 26407099 View all (19 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	29987270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	22419710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	Pubtator	36351670	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrosis congenital	Nephrotic syndrome	Pubtator	31354894	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	28087977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome, Minimal Change	Nephrotic Syndrome	BEFREE	31354894		★★★★★ ★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	31476437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	31476437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	31476437		★★★★★ ★☆☆☆☆ Found in Text Mining only
NEVUS, EPIDERMAL (disorder)	Epidermal nevus	BEFREE	24243633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	29574933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	22362819	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28027796, 28451950, 28456498, 30943313, 31211688, 31709849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	31652917	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Organoid Nevus Phakomatosis	Epidermal nevus syndrome	BEFREE	22205508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteitis Fibrosa Disseminata	Fibrous dysplasia	BEFREE	12952917, 15863037, 20841428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	22393163	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteogenesis Imperfecta	Osteogenesis imperfecta	Pubtator	35052464, 40649786	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteomalacia	Osteomalacia	BEFREE	12519781, 12952927, 16337659, 17033621, 19581284, 20841428, 21745613, 22396161, 23174215, 24006476, 25089825, 25165185, 26721590, 27754732, 27929669 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteomalacia	Osteomalacia	Pubtator	12711740, 12952917, 18379151, 19219382, 20593414, 24006476, 28982589, 32384911, 33462615, 36049757, 40133996, 40314226	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	27849387, 29467330, 29942284, 30189026, 30878966, 31496905		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	28232146, 28782829, 29665846, 29733407, 30109410, 30968207, 31044263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	31968132, 36157448	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	37627287	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	28782829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	36604721	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosclerosis	Osteosclerosis	BEFREE	22615579, 30151622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	24146310	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraneoplastic Syndromes	Paraneoplastic Syndromes	BEFREE	29381780, 31029010, 31261249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid hyperplasia	Parathyroid hyperplasia	BEFREE	28378123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	19621416		★★★★★ ★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	25730009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	39221259	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Phosphate Diabetes	Phosphate Diabetes	BEFREE	11532115, 12711740, 12952927, 16369891, 16721588, 17033625, 17635744, 18775977, 19609206, 22647968, 25618772, 27838783, 27942978, 28203361, 28246304 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Phosphate Diabetes	Phosphate Diabetes	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	28705885, 33305291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	22193235, 27450645, 27733443, 28705885, 29618028, 30064143, 30665572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic liver disease	Polycystic liver disease	BEFREE	29618028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	31709849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyostotic fibrous dysplasia	Polyostotic Fibrous Dysplasia	LHGDN	16337659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	27979879, 29325796, 30773798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	16731043, 19626341, 19730882, 27292223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	30830941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progeria	Progeria	BEFREE	31077852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive hearing loss stapes fixation	Hearing loss with stapes fixation	Pubtator	31068690, 33107440, 36719566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive hearing loss stapes fixation	Hearing loss with stapes fixation	Pubtator	31104833	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	27849387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24053368, 28110703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	30568232	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	25200959, 25324042, 37627287	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	26784541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Alveolar Microlithiasis	Pulmonary Alveolar Microlithiasis	BEFREE	20960258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	31075857	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	35263363	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rachitic rosary	Rachitic rosary	BEFREE	30827034		★★★★★ ★☆☆☆☆ Found in Text Mining only
RAINE SYNDROME	RAINE SYNDROME	BEFREE	25026495, 30151622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29940774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	27220755, 28611350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal hypophosphatemia	Renal hypophosphatemia	BEFREE	30180816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	LHGDN	15264182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	24459137, 28721153, 29309658, 29618028, 29735309, 31659218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	31487315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Restless Legs Syndrome	BEFREE	28173916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor Predisposition Syndrome 1	Rhabdoid tumor predisposition syndrome	Pubtator	37726478	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	31025926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rickets	Rickets	BEFREE	12519781, 17033621, 21346722, 21710177, 23001439, 23325605, 23939820, 24006476, 24982027, 25089825, 26751835, 29265106, 29344330, 29791829, 29991364 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rickets	Rickets	LHGDN	15930999, 18214537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rickets	Rickets	Pubtator	21050253, 23325605, 24006476, 33675347, 38493780	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rickets Hypophosphatemic	Hypophosphatemic rickets	Pubtator	20137772, 21050253, 22075221, 22695891, 26135520, 27840894, 29190002, 35352187, 35999193	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rickets Hypophosphatemic	Hypophosphatemic rickets	Pubtator	20137773, 35899574	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	28540270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scoliosis	Scoliosis	Pubtator	37192015	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scoliosis, unspecified	Scoliosis	BEFREE	29669167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	37242266	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	22205508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep-Disordered Breathing	Sleep Apnea	BEFREE	29986841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sotos Syndrome	Sotos syndrome	Pubtator	24670087	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylocostal dysostosis autosomal recessive	Spondylocostal dysostosis	Pubtator	20928885	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	27979879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29284239, 31211688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subclinical hypothyroidism	Subclinical Hypothyroidism	BEFREE	27039198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	28540270, 30562918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Taurodontism	Taurodontism	BEFREE	31834957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	24243633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	29736882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tumoral calcinosis	Tumoral Calcinosis	BEFREE	15687325, 15863037, 15930998, 16030159, 16868048, 16940445, 17276744, 17311862, 17853462, 17976082, 18682534, 19411468, 19837926, 22396161, 25378588, 25860694, 29548779, 30226830 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tumoral calcinosis	Tumoral Calcinosis	CTD_human_DG	17710231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tumoral Calcinosis Hyperphosphatemic Familial	Tumoral calcinosis	Pubtator	16960814, 17129170, 18682534, 18982401, 19865099, 20358599, 27164190, 30015621, 32360901, 33685073, 36213261, 40661832	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tumoral Calcinosis Hyperphosphatemic Familial	Tumoral calcinosis	Pubtator	32360901	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
TUMORAL CALCINOSIS, HYPERPHOSPHATEMIC, FAMILIAL	Tumoral calcinosis	ORPHANET_DG	15590700, 19188744, 22142751		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TUMORAL CALCINOSIS, HYPERPHOSPHATEMIC, FAMILIAL	Tumoral calcinosis	BEFREE	17129170, 17311862, 18982401, 19837926, 21347749, 24668887, 24680727, 25153226, 25249269, 26620085, 27164190, 27355663, 29594503, 29923062, 30015621, 30226830 View all (1 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TUMORAL CALCINOSIS, HYPERPHOSPHATEMIC, FAMILIAL	Tumoral calcinosis	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TUMORAL CALCINOSIS, HYPERPHOSPHATEMIC, FAMILIAL, 1	Tumoral calcinosis	ORPHANET_DG	15590700, 19188744, 22142751		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
TUMORAL CALCINOSIS, HYPERPHOSPHATEMIC, FAMILIAL, 1	Tumoral calcinosis	CLINVAR_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
TUMORAL CALCINOSIS, HYPERPHOSPHATEMIC, FAMILIAL, 1	Tumoral calcinosis	GENOMICS_ENGLAND_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
TUMORAL CALCINOSIS, HYPERPHOSPHATEMIC, FAMILIAL, 2	Tumoral calcinosis	GENOMICS_ENGLAND_DG	15590700		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
TUMORAL CALCINOSIS, HYPERPHOSPHATEMIC, FAMILIAL, 2	Tumoral calcinosis	UNIPROT_DG	15590700, 16030159, 16151858, 24680727		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
TUMORAL CALCINOSIS, HYPERPHOSPHATEMIC, FAMILIAL, 2	Tumoral calcinosis	CLINVAR_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Uremia	Uremia	BEFREE	27535551, 27951574, 28341272, 29056164, 29372301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	Pubtator	39799338	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	30334297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	20593414, 25378588, 26558428, 39799338	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	31542779	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	22406119, 28870151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	25324042	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	24168888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis Leukocytoclastic Cutaneous	Vasculitis	Pubtator	24006476	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Right	Ventricular dysfunction	Pubtator	37749114	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	25217649, 26681731	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	35902130	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Verrucous epidermal nevus	Verrucous Epidermal Nevus	BEFREE	27900779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	21346722, 23939820, 28173916, 28339837, 28838895, 29602956, 29991364, 29996975, 30456544, 30572348, 30726771, 30888584, 31709849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin D-Resistant Rickets, X-Linked	Vitamin D-Dependent Rickets	BEFREE	10962341, 11595624, 12111239, 12711740, 12791601, 12874285, 14988389, 15579309, 15863037, 15940367, 16076372, 16337659, 16358215, 16721588, 16884396 View all (60 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only

FGF23 (fibroblast growth factor 23)