Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	80700
Gene name	UBX domain protein 6
Gene symbol	UBXN6
Synonyms (NCBI Gene)	UBXD1UBXDC2
Chromosome	19
Chromosome location	19p13.3

Show/Hide all (41)

miRTarBase ID	miRNA	Experiments	Reference
MIRT045110	hsa-miR-186-5p	CLASH	23622248
MIRT040969	hsa-miR-18a-3p	CLASH	23622248
MIRT1472193	hsa-miR-1286	CLIP-seq
MIRT1472194	hsa-miR-324-5p	CLIP-seq
MIRT1472195	hsa-miR-338-3p	CLIP-seq
MIRT1472196	hsa-miR-3944-5p	CLIP-seq
MIRT1472197	hsa-miR-4476	CLIP-seq
MIRT1472198	hsa-miR-4493	CLIP-seq
MIRT1472199	hsa-miR-455-5p	CLIP-seq
MIRT1472200	hsa-miR-4722-5p	CLIP-seq
MIRT1472201	hsa-miR-4753-5p	CLIP-seq
MIRT1472202	hsa-miR-1205	CLIP-seq
MIRT1472193	hsa-miR-1286	CLIP-seq
MIRT1472203	hsa-miR-1587	CLIP-seq
MIRT1472204	hsa-miR-3665	CLIP-seq
MIRT1472196	hsa-miR-3944-5p	CLIP-seq
MIRT1472205	hsa-miR-4418	CLIP-seq
MIRT1472199	hsa-miR-455-5p	CLIP-seq
MIRT1472206	hsa-miR-4637	CLIP-seq
MIRT1472207	hsa-miR-4674	CLIP-seq
MIRT1472208	hsa-miR-4699-3p	CLIP-seq
MIRT1472200	hsa-miR-4722-5p	CLIP-seq
MIRT1472209	hsa-miR-509-3-5p	CLIP-seq
MIRT1472210	hsa-miR-509-5p	CLIP-seq
MIRT1472211	hsa-miR-657	CLIP-seq
MIRT2142222	hsa-miR-1976	CLIP-seq
MIRT2142223	hsa-miR-4722-3p	CLIP-seq
MIRT2362739	hsa-miR-2355-5p	CLIP-seq
MIRT2362740	hsa-miR-3657	CLIP-seq
MIRT2362741	hsa-miR-4270	CLIP-seq
MIRT2362742	hsa-miR-4441	CLIP-seq
MIRT2362743	hsa-miR-4650-5p	CLIP-seq
MIRT2362744	hsa-miR-4760-5p	CLIP-seq
MIRT1472203	hsa-miR-1587	CLIP-seq
MIRT2656757	hsa-miR-4272	CLIP-seq
MIRT1472207	hsa-miR-4674	CLIP-seq
MIRT2656758	hsa-miR-649	CLIP-seq
MIRT1472203	hsa-miR-1587	CLIP-seq
MIRT2656757	hsa-miR-4272	CLIP-seq
MIRT1472207	hsa-miR-4674	CLIP-seq
MIRT2656758	hsa-miR-649	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	18656546, 18775313, 19275885, 21822278, 22337587, 23349634, 25416956, 27753622, 29892012, 29997244, 31515488, 32296183, 32814053, 33961781, 35271311, 37776851
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	27753622
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IDA	21822278
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005768	Component	Endosome	IDA	26475856
GO:0005768	Component	Endosome	IEA
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IDA	19275885, 21822278
GO:0005829	Component	Cytosol	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0006950	Process	Response to stress	IEA
GO:0016020	Component	Membrane	IDA	19275885
GO:0016020	Component	Membrane	IEA
GO:0016236	Process	Macroautophagy	IMP	27753622
GO:0031901	Component	Early endosome membrane	IDA	21822278
GO:0031901	Component	Early endosome membrane	IEA
GO:0031902	Component	Late endosome membrane	IDA	21822278
GO:0031902	Component	Late endosome membrane	IEA
GO:0032510	Process	Endosome to lysosome transport via multivesicular body sorting pathway	IMP	21822278
GO:0032991	Component	Protein-containing complex	IDA	21822278
GO:0036503	Process	ERAD pathway	IMP	19275885
GO:0051117	Function	ATPase binding	IMP	26475856
GO:0070062	Component	Extracellular exosome	HDA	19056867

MIM	HGNC	e!Ensembl
611946	14928	ENSG00000167671

Q9BZV1

Protein name

UBX domain-containing protein 6 (UBX domain-containing protein 1)

Protein function

May negatively regulate the ATPase activity of VCP, an ATP-driven segregase that associates with different cofactors to control a wide variety of cellular processes (PubMed:26475856). As a cofactor of VCP, it may play a role in the transport of

PDB

6SAP , 8FCL , 8FCM , 8FCN , 8FCO , 8FCP , 8FCQ , 8FCR , 8FCT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09409	PUB	168 → 255	PUB domain	Domain
PF00789	UBX	332 → 410	UBX domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Enhanced expression in testis.

Sequence

MKKFFQEFKADIKFKSAGPGQKLKESVGEKAHKEKPNQPAPRPPRQGPTNEAQMAAAAAL
ARLEQKQSRAWGPTSQDTIRNQVRKELQAEATVSGSPEAPGTNVVSEPREEGSAHLAVPG
VYFTCPLTGATLRKDQRDACIKEAILLHFSTDPVAASIMKIYTFNKDQDRVKLGVDTIAK
YLDNIHLHPEEEKYRKIKLQNKVFQERINCLEGTHEFFEAIGFQKVLLPAQDQEDPEEFY
VLSETTLAQPQSLERHKEQLLAAEPVRAKLDRQRRVFQPSPLASQFELPGDFFNLTAEEI
KREQRLRSEAVERLSVLRTKAMREKEEQRGLRKYNYTLLRVRLPDGCLLQGTFYARERLG
AVYGFVREALQSDWLPFELLASGGQKLSEDENLALNECGLVPSALLTFSWDMAVLEDIKA
AGAEPDSILKPELLSAIEKLL

Sequence length

441

Interactions

View interactions

	KEGG
	Protein processing in endoplasmic reticulum

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (4)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	26475856	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	26475856	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	27913212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only

UBXN6 (UBX domain protein 6)