FOSL1 (FOS like 1, AP-1 transcription factor subunit)

Gene

• Entrez ID: 8061
• Gene name: FOS like 1, AP-1 transcription factor subunit
• Gene symbol: FOSL1
• Synonyms (NCBI Gene): FRA, FRA1, fra-1
• Chromosome: 11
• Chromosome location: 11q13.1
• Summary: The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have bee

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006142	hsa-miR-138-5p	Luciferase reporter assay, Western blot	21969367
MIRT006142	hsa-miR-138-5p	Luciferase reporter assay, Western blot	21969367
MIRT006142	hsa-miR-138-5p	Luciferase reporter assay, Western blot	21969367
MIRT006142	hsa-miR-138-5p	Luciferase reporter assay, Western blot	21969367
MIRT006142	hsa-miR-138-5p	Luciferase reporter assay, Western blot	21969367
MIRT006142	hsa-miR-138-5p	Luciferase reporter assay, Western blot	21969367
MIRT006142	hsa-miR-138-5p	Luciferase reporter assay, Western blot	21969367
MIRT006142	hsa-miR-138-5p	Luciferase reporter assay, Western blot	21969367
MIRT006142	hsa-miR-138-5p	Luciferase reporter assay, Western blot	21969367
MIRT006142	hsa-miR-138-5p	Luciferase reporter assay, Western blot	21969367
MIRT006142	hsa-miR-138-5p	Luciferase reporter assay, Western blot	21969367
MIRT006142	hsa-miR-138-5p	Luciferase reporter assay, Western blot	21969367
MIRT006142	hsa-miR-138-5p	Luciferase reporter assay, Western blot	21969367
MIRT006142	hsa-miR-138-5p	Luciferase reporter assay, Western blot	21969367
MIRT006142	hsa-miR-138-5p	Luciferase reporter assay, Western blot	21969367
MIRT006142	hsa-miR-138-5p	Luciferase reporter assay, Western blot	21969367
MIRT006142	hsa-miR-138-5p	Luciferase reporter assay, Western blot	21969367
MIRT006142	hsa-miR-138-5p	Luciferase reporter assay, Western blot	21969367
MIRT006546	hsa-miR-34a-5p	Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	22198213
MIRT006546	hsa-miR-34a-5p	Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	22198213
MIRT006546	hsa-miR-34a-5p	Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	22198213
MIRT054239	hsa-miR-33a-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	23527086
MIRT006546	hsa-miR-34a-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	23001043
MIRT438614	hsa-miR-34c-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	23001043
MIRT006546	hsa-miR-34a-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	23001043
MIRT438614	hsa-miR-34c-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	23001043
MIRT485617	hsa-miR-1207-3p	PAR-CLIP	20371350
MIRT485616	hsa-miR-6786-5p	PAR-CLIP	20371350
MIRT485615	hsa-miR-3179	PAR-CLIP	20371350
MIRT485614	hsa-miR-3150b-3p	PAR-CLIP	20371350
MIRT485613	hsa-miR-4784	PAR-CLIP	20371350
MIRT485612	hsa-miR-3202	PAR-CLIP	20371350
MIRT485611	hsa-miR-765	PAR-CLIP	20371350
MIRT485609	hsa-miR-4747-5p	PAR-CLIP	20371350
MIRT485610	hsa-miR-5196-5p	PAR-CLIP	20371350
MIRT485608	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT485607	hsa-miR-4271	PAR-CLIP	20371350
MIRT485606	hsa-miR-4725-3p	PAR-CLIP	20371350
MIRT485605	hsa-miR-6780b-5p	PAR-CLIP	20371350
MIRT485604	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT485602	hsa-miR-625-5p	PAR-CLIP	20371350
MIRT485603	hsa-miR-4723-5p	PAR-CLIP	20371350
MIRT485601	hsa-miR-5698	PAR-CLIP	20371350
MIRT485600	hsa-miR-6870-5p	PAR-CLIP	20371350
MIRT485599	hsa-miR-7111-5p	PAR-CLIP	20371350
MIRT485598	hsa-miR-4525	PAR-CLIP	20371350
MIRT485597	hsa-miR-5010-5p	PAR-CLIP	20371350
MIRT485596	hsa-miR-92a-2-5p	PAR-CLIP	20371350
MIRT485595	hsa-miR-4447	PAR-CLIP	20371350
MIRT485593	hsa-miR-4472	PAR-CLIP	20371350
MIRT485594	hsa-miR-1275	PAR-CLIP	20371350
MIRT485592	hsa-miR-4665-5p	PAR-CLIP	20371350
MIRT485591	hsa-miR-7109-5p	PAR-CLIP	20371350
MIRT485617	hsa-miR-1207-3p	PAR-CLIP	20371350
MIRT485616	hsa-miR-6786-5p	PAR-CLIP	20371350
MIRT485615	hsa-miR-3179	PAR-CLIP	20371350
MIRT485614	hsa-miR-3150b-3p	PAR-CLIP	20371350
MIRT485613	hsa-miR-4784	PAR-CLIP	20371350
MIRT485612	hsa-miR-3202	PAR-CLIP	20371350
MIRT485611	hsa-miR-765	PAR-CLIP	20371350
MIRT485609	hsa-miR-4747-5p	PAR-CLIP	20371350
MIRT485610	hsa-miR-5196-5p	PAR-CLIP	20371350
MIRT485608	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT485607	hsa-miR-4271	PAR-CLIP	20371350
MIRT485606	hsa-miR-4725-3p	PAR-CLIP	20371350
MIRT485605	hsa-miR-6780b-5p	PAR-CLIP	20371350
MIRT485604	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT485602	hsa-miR-625-5p	PAR-CLIP	20371350
MIRT485603	hsa-miR-4723-5p	PAR-CLIP	20371350
MIRT485601	hsa-miR-5698	PAR-CLIP	20371350
MIRT485600	hsa-miR-6870-5p	PAR-CLIP	20371350
MIRT485599	hsa-miR-7111-5p	PAR-CLIP	20371350
MIRT485598	hsa-miR-4525	PAR-CLIP	20371350
MIRT485597	hsa-miR-5010-5p	PAR-CLIP	20371350
MIRT485596	hsa-miR-92a-2-5p	PAR-CLIP	20371350
MIRT485595	hsa-miR-4447	PAR-CLIP	20371350
MIRT485593	hsa-miR-4472	PAR-CLIP	20371350
MIRT485594	hsa-miR-1275	PAR-CLIP	20371350
MIRT485592	hsa-miR-4665-5p	PAR-CLIP	20371350
MIRT485591	hsa-miR-7109-5p	PAR-CLIP	20371350
MIRT485617	hsa-miR-1207-3p	PAR-CLIP	20371350
MIRT485616	hsa-miR-6786-5p	PAR-CLIP	20371350
MIRT485615	hsa-miR-3179	PAR-CLIP	20371350
MIRT485614	hsa-miR-3150b-3p	PAR-CLIP	20371350
MIRT485613	hsa-miR-4784	PAR-CLIP	20371350
MIRT485612	hsa-miR-3202	PAR-CLIP	20371350
MIRT485611	hsa-miR-765	PAR-CLIP	20371350
MIRT485609	hsa-miR-4747-5p	PAR-CLIP	20371350
MIRT485610	hsa-miR-5196-5p	PAR-CLIP	20371350
MIRT485608	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT485607	hsa-miR-4271	PAR-CLIP	20371350
MIRT485606	hsa-miR-4725-3p	PAR-CLIP	20371350
MIRT485605	hsa-miR-6780b-5p	PAR-CLIP	20371350
MIRT485604	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT485602	hsa-miR-625-5p	PAR-CLIP	20371350
MIRT485603	hsa-miR-4723-5p	PAR-CLIP	20371350
MIRT485601	hsa-miR-5698	PAR-CLIP	20371350
MIRT485600	hsa-miR-6870-5p	PAR-CLIP	20371350
MIRT485599	hsa-miR-7111-5p	PAR-CLIP	20371350
MIRT485598	hsa-miR-4525	PAR-CLIP	20371350
MIRT485597	hsa-miR-5010-5p	PAR-CLIP	20371350
MIRT485596	hsa-miR-92a-2-5p	PAR-CLIP	20371350
MIRT485595	hsa-miR-4447	PAR-CLIP	20371350
MIRT485593	hsa-miR-4472	PAR-CLIP	20371350
MIRT485594	hsa-miR-1275	PAR-CLIP	20371350
MIRT485592	hsa-miR-4665-5p	PAR-CLIP	20371350
MIRT485591	hsa-miR-7109-5p	PAR-CLIP	20371350
MIRT485617	hsa-miR-1207-3p	PAR-CLIP	23592263
MIRT485616	hsa-miR-6786-5p	PAR-CLIP	23592263
MIRT485615	hsa-miR-3179	PAR-CLIP	23592263
MIRT485614	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT485613	hsa-miR-4784	PAR-CLIP	23592263
MIRT485612	hsa-miR-3202	PAR-CLIP	23592263
MIRT485611	hsa-miR-765	PAR-CLIP	23592263
MIRT485609	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT485610	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT485608	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT485607	hsa-miR-4271	PAR-CLIP	23592263
MIRT485606	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT485605	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT485604	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT485602	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT485603	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT485601	hsa-miR-5698	PAR-CLIP	23592263
MIRT485600	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT485599	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT485598	hsa-miR-4525	PAR-CLIP	23592263
MIRT485597	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT485596	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT485595	hsa-miR-4447	PAR-CLIP	23592263
MIRT485593	hsa-miR-4472	PAR-CLIP	23592263
MIRT485594	hsa-miR-1275	PAR-CLIP	23592263
MIRT485592	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT485591	hsa-miR-7109-5p	PAR-CLIP	23592263
MIRT485617	hsa-miR-1207-3p	PAR-CLIP	23592263
MIRT485616	hsa-miR-6786-5p	PAR-CLIP	23592263
MIRT485615	hsa-miR-3179	PAR-CLIP	23592263
MIRT485614	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT485613	hsa-miR-4784	PAR-CLIP	23592263
MIRT485612	hsa-miR-3202	PAR-CLIP	23592263
MIRT485611	hsa-miR-765	PAR-CLIP	23592263
MIRT485609	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT485610	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT485608	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT485607	hsa-miR-4271	PAR-CLIP	23592263
MIRT485606	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT485605	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT485604	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT485602	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT485603	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT485601	hsa-miR-5698	PAR-CLIP	23592263
MIRT485600	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT485599	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT485598	hsa-miR-4525	PAR-CLIP	23592263
MIRT485597	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT485596	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT485595	hsa-miR-4447	PAR-CLIP	23592263
MIRT485593	hsa-miR-4472	PAR-CLIP	23592263
MIRT485594	hsa-miR-1275	PAR-CLIP	23592263
MIRT485592	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT485591	hsa-miR-7109-5p	PAR-CLIP	23592263
MIRT485617	hsa-miR-1207-3p	PAR-CLIP	26701625
MIRT485617	hsa-miR-1207-3p	PAR-CLIP	26701625
MIRT485617	hsa-miR-1207-3p	PAR-CLIP	26701625
MIRT485617	hsa-miR-1207-3p	PAR-CLIP	26701625
MIRT485617	hsa-miR-1207-3p	PAR-CLIP	26701625
MIRT485617	hsa-miR-1207-3p	PAR-CLIP	26701625
MIRT485617	hsa-miR-1207-3p	PAR-CLIP	26701625
MIRT485617	hsa-miR-1207-3p	PAR-CLIP	26701625
MIRT485617	hsa-miR-1207-3p	PAR-CLIP	26701625
MIRT485617	hsa-miR-1207-3p	PAR-CLIP	26701625
MIRT485617	hsa-miR-1207-3p	PAR-CLIP	26701625
MIRT485617	hsa-miR-1207-3p	PAR-CLIP	26701625
MIRT485594	hsa-miR-1275	PAR-CLIP	26701625
MIRT485594	hsa-miR-1275	PAR-CLIP	26701625
MIRT485594	hsa-miR-1275	PAR-CLIP	26701625
MIRT485594	hsa-miR-1275	PAR-CLIP	26701625
MIRT485594	hsa-miR-1275	PAR-CLIP	26701625
MIRT485594	hsa-miR-1275	PAR-CLIP	26701625
MIRT485594	hsa-miR-1275	PAR-CLIP	26701625
MIRT485594	hsa-miR-1275	PAR-CLIP	26701625
MIRT485594	hsa-miR-1275	PAR-CLIP	26701625
MIRT485594	hsa-miR-1275	PAR-CLIP	26701625
MIRT485594	hsa-miR-1275	PAR-CLIP	26701625
MIRT485594	hsa-miR-1275	PAR-CLIP	26701625
MIRT485614	hsa-miR-3150b-3p	PAR-CLIP	26701625
MIRT485614	hsa-miR-3150b-3p	PAR-CLIP	26701625
MIRT485614	hsa-miR-3150b-3p	PAR-CLIP	26701625
MIRT485614	hsa-miR-3150b-3p	PAR-CLIP	26701625
MIRT485614	hsa-miR-3150b-3p	PAR-CLIP	26701625
MIRT485614	hsa-miR-3150b-3p	PAR-CLIP	26701625
MIRT485614	hsa-miR-3150b-3p	PAR-CLIP	26701625
MIRT485614	hsa-miR-3150b-3p	PAR-CLIP	26701625
MIRT485614	hsa-miR-3150b-3p	PAR-CLIP	26701625
MIRT485614	hsa-miR-3150b-3p	PAR-CLIP	26701625
MIRT485614	hsa-miR-3150b-3p	PAR-CLIP	26701625
MIRT485614	hsa-miR-3150b-3p	PAR-CLIP	26701625
MIRT485615	hsa-miR-3179	PAR-CLIP	26701625
MIRT485615	hsa-miR-3179	PAR-CLIP	26701625
MIRT485615	hsa-miR-3179	PAR-CLIP	26701625
MIRT485615	hsa-miR-3179	PAR-CLIP	26701625
MIRT485615	hsa-miR-3179	PAR-CLIP	26701625
MIRT485615	hsa-miR-3179	PAR-CLIP	26701625
MIRT485615	hsa-miR-3179	PAR-CLIP	26701625
MIRT485615	hsa-miR-3179	PAR-CLIP	26701625
MIRT485615	hsa-miR-3179	PAR-CLIP	26701625
MIRT485615	hsa-miR-3179	PAR-CLIP	26701625
MIRT485615	hsa-miR-3179	PAR-CLIP	26701625
MIRT485615	hsa-miR-3179	PAR-CLIP	26701625
MIRT485615	hsa-miR-3179	PAR-CLIP	26701625
MIRT485615	hsa-miR-3179	PAR-CLIP	26701625
MIRT485615	hsa-miR-3179	PAR-CLIP	26701625
MIRT485612	hsa-miR-3202	PAR-CLIP	26701625
MIRT485612	hsa-miR-3202	PAR-CLIP	26701625
MIRT485612	hsa-miR-3202	PAR-CLIP	26701625
MIRT485612	hsa-miR-3202	PAR-CLIP	26701625
MIRT485612	hsa-miR-3202	PAR-CLIP	26701625
MIRT485612	hsa-miR-3202	PAR-CLIP	26701625
MIRT485612	hsa-miR-3202	PAR-CLIP	26701625
MIRT485612	hsa-miR-3202	PAR-CLIP	26701625
MIRT485612	hsa-miR-3202	PAR-CLIP	26701625
MIRT485612	hsa-miR-3202	PAR-CLIP	26701625
MIRT485612	hsa-miR-3202	PAR-CLIP	26701625
MIRT485612	hsa-miR-3202	PAR-CLIP	26701625
MIRT485612	hsa-miR-3202	PAR-CLIP	26701625
MIRT485612	hsa-miR-3202	PAR-CLIP	26701625
MIRT006546	hsa-miR-34a-5p	PAR-CLIP	26701625
MIRT006546	hsa-miR-34a-5p	PAR-CLIP	26701625
MIRT006546	hsa-miR-34a-5p	PAR-CLIP	26701625
MIRT006546	hsa-miR-34a-5p	PAR-CLIP	26701625
MIRT006546	hsa-miR-34a-5p	PAR-CLIP	26701625
MIRT006546	hsa-miR-34a-5p	PAR-CLIP	26701625
MIRT006546	hsa-miR-34a-5p	PAR-CLIP	26701625
MIRT006546	hsa-miR-34a-5p	PAR-CLIP	26701625
MIRT438614	hsa-miR-34c-5p	PAR-CLIP	26701625
MIRT438614	hsa-miR-34c-5p	PAR-CLIP	26701625
MIRT438614	hsa-miR-34c-5p	PAR-CLIP	26701625
MIRT438614	hsa-miR-34c-5p	PAR-CLIP	26701625
MIRT438614	hsa-miR-34c-5p	PAR-CLIP	26701625
MIRT438614	hsa-miR-34c-5p	PAR-CLIP	26701625
MIRT438614	hsa-miR-34c-5p	PAR-CLIP	26701625
MIRT438614	hsa-miR-34c-5p	PAR-CLIP	26701625
MIRT485607	hsa-miR-4271	PAR-CLIP	26701625
MIRT485607	hsa-miR-4271	PAR-CLIP	26701625
MIRT485607	hsa-miR-4271	PAR-CLIP	26701625
MIRT485607	hsa-miR-4271	PAR-CLIP	26701625
MIRT485607	hsa-miR-4271	PAR-CLIP	26701625
MIRT485607	hsa-miR-4271	PAR-CLIP	26701625
MIRT485607	hsa-miR-4271	PAR-CLIP	26701625
MIRT485607	hsa-miR-4271	PAR-CLIP	26701625
MIRT485607	hsa-miR-4271	PAR-CLIP	26701625
MIRT485607	hsa-miR-4271	PAR-CLIP	26701625
MIRT485607	hsa-miR-4271	PAR-CLIP	26701625
MIRT485607	hsa-miR-4271	PAR-CLIP	26701625
MIRT485595	hsa-miR-4447	PAR-CLIP	26701625
MIRT485595	hsa-miR-4447	PAR-CLIP	26701625
MIRT485595	hsa-miR-4447	PAR-CLIP	26701625
MIRT485595	hsa-miR-4447	PAR-CLIP	26701625
MIRT485595	hsa-miR-4447	PAR-CLIP	26701625
MIRT485595	hsa-miR-4447	PAR-CLIP	26701625
MIRT485595	hsa-miR-4447	PAR-CLIP	26701625
MIRT485595	hsa-miR-4447	PAR-CLIP	26701625
MIRT485595	hsa-miR-4447	PAR-CLIP	26701625
MIRT485595	hsa-miR-4447	PAR-CLIP	26701625
MIRT485595	hsa-miR-4447	PAR-CLIP	26701625
MIRT485595	hsa-miR-4447	PAR-CLIP	26701625
MIRT485593	hsa-miR-4472	PAR-CLIP	26701625
MIRT485593	hsa-miR-4472	PAR-CLIP	26701625
MIRT485593	hsa-miR-4472	PAR-CLIP	26701625
MIRT485593	hsa-miR-4472	PAR-CLIP	26701625
MIRT485593	hsa-miR-4472	PAR-CLIP	26701625
MIRT485593	hsa-miR-4472	PAR-CLIP	26701625
MIRT485593	hsa-miR-4472	PAR-CLIP	26701625
MIRT485593	hsa-miR-4472	PAR-CLIP	26701625
MIRT485593	hsa-miR-4472	PAR-CLIP	26701625
MIRT485593	hsa-miR-4472	PAR-CLIP	26701625
MIRT485593	hsa-miR-4472	PAR-CLIP	26701625
MIRT485593	hsa-miR-4472	PAR-CLIP	26701625
MIRT485598	hsa-miR-4525	PAR-CLIP	26701625
MIRT485598	hsa-miR-4525	PAR-CLIP	26701625
MIRT485598	hsa-miR-4525	PAR-CLIP	26701625
MIRT485598	hsa-miR-4525	PAR-CLIP	26701625
MIRT485598	hsa-miR-4525	PAR-CLIP	26701625
MIRT485598	hsa-miR-4525	PAR-CLIP	26701625
MIRT485598	hsa-miR-4525	PAR-CLIP	26701625
MIRT485598	hsa-miR-4525	PAR-CLIP	26701625
MIRT485598	hsa-miR-4525	PAR-CLIP	26701625
MIRT485598	hsa-miR-4525	PAR-CLIP	26701625
MIRT485598	hsa-miR-4525	PAR-CLIP	26701625
MIRT485598	hsa-miR-4525	PAR-CLIP	26701625
MIRT485592	hsa-miR-4665-5p	PAR-CLIP	26701625
MIRT485592	hsa-miR-4665-5p	PAR-CLIP	26701625
MIRT485592	hsa-miR-4665-5p	PAR-CLIP	26701625
MIRT485592	hsa-miR-4665-5p	PAR-CLIP	26701625
MIRT485592	hsa-miR-4665-5p	PAR-CLIP	26701625
MIRT485592	hsa-miR-4665-5p	PAR-CLIP	26701625
MIRT485592	hsa-miR-4665-5p	PAR-CLIP	26701625
MIRT485592	hsa-miR-4665-5p	PAR-CLIP	26701625
MIRT485592	hsa-miR-4665-5p	PAR-CLIP	26701625
MIRT485592	hsa-miR-4665-5p	PAR-CLIP	26701625
MIRT485592	hsa-miR-4665-5p	PAR-CLIP	26701625
MIRT485592	hsa-miR-4665-5p	PAR-CLIP	26701625
MIRT485603	hsa-miR-4723-5p	PAR-CLIP	26701625
MIRT485603	hsa-miR-4723-5p	PAR-CLIP	26701625
MIRT485603	hsa-miR-4723-5p	PAR-CLIP	26701625
MIRT485603	hsa-miR-4723-5p	PAR-CLIP	26701625
MIRT485603	hsa-miR-4723-5p	PAR-CLIP	26701625
MIRT485603	hsa-miR-4723-5p	PAR-CLIP	26701625
MIRT485603	hsa-miR-4723-5p	PAR-CLIP	26701625
MIRT485603	hsa-miR-4723-5p	PAR-CLIP	26701625
MIRT485603	hsa-miR-4723-5p	PAR-CLIP	26701625
MIRT485603	hsa-miR-4723-5p	PAR-CLIP	26701625
MIRT485603	hsa-miR-4723-5p	PAR-CLIP	26701625
MIRT485603	hsa-miR-4723-5p	PAR-CLIP	26701625
MIRT485606	hsa-miR-4725-3p	PAR-CLIP	26701625
MIRT485606	hsa-miR-4725-3p	PAR-CLIP	26701625
MIRT485606	hsa-miR-4725-3p	PAR-CLIP	26701625
MIRT485606	hsa-miR-4725-3p	PAR-CLIP	26701625
MIRT485606	hsa-miR-4725-3p	PAR-CLIP	26701625
MIRT485606	hsa-miR-4725-3p	PAR-CLIP	26701625
MIRT485606	hsa-miR-4725-3p	PAR-CLIP	26701625
MIRT485606	hsa-miR-4725-3p	PAR-CLIP	26701625
MIRT485606	hsa-miR-4725-3p	PAR-CLIP	26701625
MIRT485606	hsa-miR-4725-3p	PAR-CLIP	26701625
MIRT485606	hsa-miR-4725-3p	PAR-CLIP	26701625
MIRT485606	hsa-miR-4725-3p	PAR-CLIP	26701625
MIRT485609	hsa-miR-4747-5p	PAR-CLIP	26701625
MIRT485609	hsa-miR-4747-5p	PAR-CLIP	26701625
MIRT485609	hsa-miR-4747-5p	PAR-CLIP	26701625
MIRT485609	hsa-miR-4747-5p	PAR-CLIP	26701625
MIRT485609	hsa-miR-4747-5p	PAR-CLIP	26701625
MIRT485609	hsa-miR-4747-5p	PAR-CLIP	26701625
MIRT485609	hsa-miR-4747-5p	PAR-CLIP	26701625
MIRT485609	hsa-miR-4747-5p	PAR-CLIP	26701625
MIRT485609	hsa-miR-4747-5p	PAR-CLIP	26701625
MIRT485609	hsa-miR-4747-5p	PAR-CLIP	26701625
MIRT485609	hsa-miR-4747-5p	PAR-CLIP	26701625
MIRT485609	hsa-miR-4747-5p	PAR-CLIP	26701625
MIRT485613	hsa-miR-4784	PAR-CLIP	26701625
MIRT485613	hsa-miR-4784	PAR-CLIP	26701625
MIRT485613	hsa-miR-4784	PAR-CLIP	26701625
MIRT485613	hsa-miR-4784	PAR-CLIP	26701625
MIRT485613	hsa-miR-4784	PAR-CLIP	26701625
MIRT485613	hsa-miR-4784	PAR-CLIP	26701625
MIRT485613	hsa-miR-4784	PAR-CLIP	26701625
MIRT485613	hsa-miR-4784	PAR-CLIP	26701625
MIRT485613	hsa-miR-4784	PAR-CLIP	26701625
MIRT485613	hsa-miR-4784	PAR-CLIP	26701625
MIRT485613	hsa-miR-4784	PAR-CLIP	26701625
MIRT485613	hsa-miR-4784	PAR-CLIP	26701625
MIRT485597	hsa-miR-5010-5p	PAR-CLIP	26701625
MIRT485597	hsa-miR-5010-5p	PAR-CLIP	26701625
MIRT485597	hsa-miR-5010-5p	PAR-CLIP	26701625
MIRT485597	hsa-miR-5010-5p	PAR-CLIP	26701625
MIRT485597	hsa-miR-5010-5p	PAR-CLIP	26701625
MIRT485597	hsa-miR-5010-5p	PAR-CLIP	26701625
MIRT485597	hsa-miR-5010-5p	PAR-CLIP	26701625
MIRT485597	hsa-miR-5010-5p	PAR-CLIP	26701625
MIRT485597	hsa-miR-5010-5p	PAR-CLIP	26701625
MIRT485597	hsa-miR-5010-5p	PAR-CLIP	26701625
MIRT485597	hsa-miR-5010-5p	PAR-CLIP	26701625
MIRT485597	hsa-miR-5010-5p	PAR-CLIP	26701625
MIRT485610	hsa-miR-5196-5p	PAR-CLIP	26701625
MIRT485610	hsa-miR-5196-5p	PAR-CLIP	26701625
MIRT485610	hsa-miR-5196-5p	PAR-CLIP	26701625
MIRT485610	hsa-miR-5196-5p	PAR-CLIP	26701625
MIRT485610	hsa-miR-5196-5p	PAR-CLIP	26701625
MIRT485610	hsa-miR-5196-5p	PAR-CLIP	26701625
MIRT485610	hsa-miR-5196-5p	PAR-CLIP	26701625
MIRT485610	hsa-miR-5196-5p	PAR-CLIP	26701625
MIRT485610	hsa-miR-5196-5p	PAR-CLIP	26701625
MIRT485610	hsa-miR-5196-5p	PAR-CLIP	26701625
MIRT485610	hsa-miR-5196-5p	PAR-CLIP	26701625
MIRT485610	hsa-miR-5196-5p	PAR-CLIP	26701625
MIRT485601	hsa-miR-5698	PAR-CLIP	26701625
MIRT485601	hsa-miR-5698	PAR-CLIP	26701625
MIRT485601	hsa-miR-5698	PAR-CLIP	26701625
MIRT485601	hsa-miR-5698	PAR-CLIP	26701625
MIRT485601	hsa-miR-5698	PAR-CLIP	26701625
MIRT485601	hsa-miR-5698	PAR-CLIP	26701625
MIRT485601	hsa-miR-5698	PAR-CLIP	26701625
MIRT485601	hsa-miR-5698	PAR-CLIP	26701625
MIRT485601	hsa-miR-5698	PAR-CLIP	26701625
MIRT485601	hsa-miR-5698	PAR-CLIP	26701625
MIRT485601	hsa-miR-5698	PAR-CLIP	26701625
MIRT485601	hsa-miR-5698	PAR-CLIP	26701625
MIRT485602	hsa-miR-625-5p	PAR-CLIP	26701625
MIRT485602	hsa-miR-625-5p	PAR-CLIP	26701625
MIRT485602	hsa-miR-625-5p	PAR-CLIP	26701625
MIRT485602	hsa-miR-625-5p	PAR-CLIP	26701625
MIRT485602	hsa-miR-625-5p	PAR-CLIP	26701625
MIRT485602	hsa-miR-625-5p	PAR-CLIP	26701625
MIRT485602	hsa-miR-625-5p	PAR-CLIP	26701625
MIRT485602	hsa-miR-625-5p	PAR-CLIP	26701625
MIRT485602	hsa-miR-625-5p	PAR-CLIP	26701625
MIRT485602	hsa-miR-625-5p	PAR-CLIP	26701625
MIRT485602	hsa-miR-625-5p	PAR-CLIP	26701625
MIRT485602	hsa-miR-625-5p	PAR-CLIP	26701625
MIRT485605	hsa-miR-6780b-5p	PAR-CLIP	26701625
MIRT485605	hsa-miR-6780b-5p	PAR-CLIP	26701625
MIRT485605	hsa-miR-6780b-5p	PAR-CLIP	26701625
MIRT485605	hsa-miR-6780b-5p	PAR-CLIP	26701625
MIRT485605	hsa-miR-6780b-5p	PAR-CLIP	26701625
MIRT485605	hsa-miR-6780b-5p	PAR-CLIP	26701625
MIRT485605	hsa-miR-6780b-5p	PAR-CLIP	26701625
MIRT485605	hsa-miR-6780b-5p	PAR-CLIP	26701625
MIRT485605	hsa-miR-6780b-5p	PAR-CLIP	26701625
MIRT485605	hsa-miR-6780b-5p	PAR-CLIP	26701625
MIRT485605	hsa-miR-6780b-5p	PAR-CLIP	26701625
MIRT485605	hsa-miR-6780b-5p	PAR-CLIP	26701625
MIRT485616	hsa-miR-6786-5p	PAR-CLIP	26701625
MIRT485616	hsa-miR-6786-5p	PAR-CLIP	26701625
MIRT485616	hsa-miR-6786-5p	PAR-CLIP	26701625
MIRT485616	hsa-miR-6786-5p	PAR-CLIP	26701625
MIRT485616	hsa-miR-6786-5p	PAR-CLIP	26701625
MIRT485616	hsa-miR-6786-5p	PAR-CLIP	26701625
MIRT485616	hsa-miR-6786-5p	PAR-CLIP	26701625
MIRT485616	hsa-miR-6786-5p	PAR-CLIP	26701625
MIRT485616	hsa-miR-6786-5p	PAR-CLIP	26701625
MIRT485616	hsa-miR-6786-5p	PAR-CLIP	26701625
MIRT485616	hsa-miR-6786-5p	PAR-CLIP	26701625
MIRT485616	hsa-miR-6786-5p	PAR-CLIP	26701625
MIRT485604	hsa-miR-6825-5p	PAR-CLIP	26701625
MIRT485604	hsa-miR-6825-5p	PAR-CLIP	26701625
MIRT485604	hsa-miR-6825-5p	PAR-CLIP	26701625
MIRT485604	hsa-miR-6825-5p	PAR-CLIP	26701625
MIRT485604	hsa-miR-6825-5p	PAR-CLIP	26701625
MIRT485604	hsa-miR-6825-5p	PAR-CLIP	26701625
MIRT485604	hsa-miR-6825-5p	PAR-CLIP	26701625
MIRT485604	hsa-miR-6825-5p	PAR-CLIP	26701625
MIRT485604	hsa-miR-6825-5p	PAR-CLIP	26701625
MIRT485604	hsa-miR-6825-5p	PAR-CLIP	26701625
MIRT485604	hsa-miR-6825-5p	PAR-CLIP	26701625
MIRT485604	hsa-miR-6825-5p	PAR-CLIP	26701625
MIRT485600	hsa-miR-6870-5p	PAR-CLIP	26701625
MIRT485600	hsa-miR-6870-5p	PAR-CLIP	26701625
MIRT485600	hsa-miR-6870-5p	PAR-CLIP	26701625
MIRT485600	hsa-miR-6870-5p	PAR-CLIP	26701625
MIRT485600	hsa-miR-6870-5p	PAR-CLIP	26701625
MIRT485600	hsa-miR-6870-5p	PAR-CLIP	26701625
MIRT485600	hsa-miR-6870-5p	PAR-CLIP	26701625
MIRT485600	hsa-miR-6870-5p	PAR-CLIP	26701625
MIRT485600	hsa-miR-6870-5p	PAR-CLIP	26701625
MIRT485600	hsa-miR-6870-5p	PAR-CLIP	26701625
MIRT485600	hsa-miR-6870-5p	PAR-CLIP	26701625
MIRT485600	hsa-miR-6870-5p	PAR-CLIP	26701625
MIRT485608	hsa-miR-7106-5p	PAR-CLIP	26701625
MIRT485608	hsa-miR-7106-5p	PAR-CLIP	26701625
MIRT485608	hsa-miR-7106-5p	PAR-CLIP	26701625
MIRT485608	hsa-miR-7106-5p	PAR-CLIP	26701625
MIRT485608	hsa-miR-7106-5p	PAR-CLIP	26701625
MIRT485608	hsa-miR-7106-5p	PAR-CLIP	26701625
MIRT485608	hsa-miR-7106-5p	PAR-CLIP	26701625
MIRT485608	hsa-miR-7106-5p	PAR-CLIP	26701625
MIRT485608	hsa-miR-7106-5p	PAR-CLIP	26701625
MIRT485608	hsa-miR-7106-5p	PAR-CLIP	26701625
MIRT485608	hsa-miR-7106-5p	PAR-CLIP	26701625
MIRT485608	hsa-miR-7106-5p	PAR-CLIP	26701625
MIRT485591	hsa-miR-7109-5p	PAR-CLIP	26701625
MIRT485591	hsa-miR-7109-5p	PAR-CLIP	26701625
MIRT485591	hsa-miR-7109-5p	PAR-CLIP	26701625
MIRT485591	hsa-miR-7109-5p	PAR-CLIP	26701625
MIRT485591	hsa-miR-7109-5p	PAR-CLIP	26701625
MIRT485591	hsa-miR-7109-5p	PAR-CLIP	26701625
MIRT485591	hsa-miR-7109-5p	PAR-CLIP	26701625
MIRT485591	hsa-miR-7109-5p	PAR-CLIP	26701625
MIRT485591	hsa-miR-7109-5p	PAR-CLIP	26701625
MIRT485591	hsa-miR-7109-5p	PAR-CLIP	26701625
MIRT485591	hsa-miR-7109-5p	PAR-CLIP	26701625
MIRT485591	hsa-miR-7109-5p	PAR-CLIP	26701625
MIRT485599	hsa-miR-7111-5p	PAR-CLIP	26701625
MIRT485599	hsa-miR-7111-5p	PAR-CLIP	26701625
MIRT485599	hsa-miR-7111-5p	PAR-CLIP	26701625
MIRT485599	hsa-miR-7111-5p	PAR-CLIP	26701625
MIRT485599	hsa-miR-7111-5p	PAR-CLIP	26701625
MIRT485599	hsa-miR-7111-5p	PAR-CLIP	26701625
MIRT485599	hsa-miR-7111-5p	PAR-CLIP	26701625
MIRT485599	hsa-miR-7111-5p	PAR-CLIP	26701625
MIRT485599	hsa-miR-7111-5p	PAR-CLIP	26701625
MIRT485599	hsa-miR-7111-5p	PAR-CLIP	26701625
MIRT485599	hsa-miR-7111-5p	PAR-CLIP	26701625
MIRT485599	hsa-miR-7111-5p	PAR-CLIP	26701625
MIRT485611	hsa-miR-765	PAR-CLIP	26701625
MIRT485611	hsa-miR-765	PAR-CLIP	26701625
MIRT485611	hsa-miR-765	PAR-CLIP	26701625
MIRT485611	hsa-miR-765	PAR-CLIP	26701625
MIRT485611	hsa-miR-765	PAR-CLIP	26701625
MIRT485611	hsa-miR-765	PAR-CLIP	26701625
MIRT485611	hsa-miR-765	PAR-CLIP	26701625
MIRT485611	hsa-miR-765	PAR-CLIP	26701625
MIRT485611	hsa-miR-765	PAR-CLIP	26701625
MIRT485611	hsa-miR-765	PAR-CLIP	26701625
MIRT485611	hsa-miR-765	PAR-CLIP	26701625
MIRT485611	hsa-miR-765	PAR-CLIP	26701625
MIRT485596	hsa-miR-92a-2-5p	PAR-CLIP	26701625
MIRT485596	hsa-miR-92a-2-5p	PAR-CLIP	26701625
MIRT485596	hsa-miR-92a-2-5p	PAR-CLIP	26701625
MIRT485596	hsa-miR-92a-2-5p	PAR-CLIP	26701625
MIRT485596	hsa-miR-92a-2-5p	PAR-CLIP	26701625
MIRT485596	hsa-miR-92a-2-5p	PAR-CLIP	26701625
MIRT485596	hsa-miR-92a-2-5p	PAR-CLIP	26701625
MIRT485596	hsa-miR-92a-2-5p	PAR-CLIP	26701625
MIRT485596	hsa-miR-92a-2-5p	PAR-CLIP	26701625
MIRT485596	hsa-miR-92a-2-5p	PAR-CLIP	26701625
MIRT485596	hsa-miR-92a-2-5p	PAR-CLIP	26701625
MIRT485596	hsa-miR-92a-2-5p	PAR-CLIP	26701625
MIRT737155	hsa-miR-34a-3p	Western blotting, Immunohistochemistry (IHC), qRT-PCR	33614246
MIRT737155	hsa-miR-34a-3p	Northern blotting, Immunohistochemistry (IHC), qRT-PCR	33614246
MIRT485617	hsa-miR-1207-3p	PAR-CLIP	20371350
MIRT485616	hsa-miR-6786-5p	PAR-CLIP	20371350
MIRT485615	hsa-miR-3179	PAR-CLIP	20371350
MIRT485614	hsa-miR-3150b-3p	PAR-CLIP	20371350
MIRT485613	hsa-miR-4784	PAR-CLIP	20371350
MIRT485612	hsa-miR-3202	PAR-CLIP	20371350
MIRT485611	hsa-miR-765	PAR-CLIP	20371350
MIRT485609	hsa-miR-4747-5p	PAR-CLIP	20371350
MIRT485610	hsa-miR-5196-5p	PAR-CLIP	20371350
MIRT485608	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT485607	hsa-miR-4271	PAR-CLIP	20371350
MIRT485606	hsa-miR-4725-3p	PAR-CLIP	20371350
MIRT485605	hsa-miR-6780b-5p	PAR-CLIP	20371350
MIRT485604	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT485602	hsa-miR-625-5p	PAR-CLIP	20371350
MIRT485603	hsa-miR-4723-5p	PAR-CLIP	20371350
MIRT485601	hsa-miR-5698	PAR-CLIP	20371350
MIRT485600	hsa-miR-6870-5p	PAR-CLIP	20371350
MIRT485599	hsa-miR-7111-5p	PAR-CLIP	20371350
MIRT485598	hsa-miR-4525	PAR-CLIP	20371350
MIRT485597	hsa-miR-5010-5p	PAR-CLIP	20371350
MIRT485596	hsa-miR-92a-2-5p	PAR-CLIP	20371350
MIRT485595	hsa-miR-4447	PAR-CLIP	20371350
MIRT485593	hsa-miR-4472	PAR-CLIP	20371350
MIRT485594	hsa-miR-1275	PAR-CLIP	20371350
MIRT485592	hsa-miR-4665-5p	PAR-CLIP	20371350
MIRT485591	hsa-miR-7109-5p	PAR-CLIP	20371350
MIRT485617	hsa-miR-1207-3p	PAR-CLIP	20371350
MIRT485616	hsa-miR-6786-5p	PAR-CLIP	20371350
MIRT485615	hsa-miR-3179	PAR-CLIP	20371350
MIRT485614	hsa-miR-3150b-3p	PAR-CLIP	20371350
MIRT485613	hsa-miR-4784	PAR-CLIP	20371350
MIRT485612	hsa-miR-3202	PAR-CLIP	20371350
MIRT485611	hsa-miR-765	PAR-CLIP	20371350
MIRT485609	hsa-miR-4747-5p	PAR-CLIP	20371350
MIRT485610	hsa-miR-5196-5p	PAR-CLIP	20371350
MIRT485608	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT485607	hsa-miR-4271	PAR-CLIP	20371350
MIRT485606	hsa-miR-4725-3p	PAR-CLIP	20371350
MIRT485605	hsa-miR-6780b-5p	PAR-CLIP	20371350
MIRT485604	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT485602	hsa-miR-625-5p	PAR-CLIP	20371350
MIRT485603	hsa-miR-4723-5p	PAR-CLIP	20371350
MIRT485601	hsa-miR-5698	PAR-CLIP	20371350
MIRT485600	hsa-miR-6870-5p	PAR-CLIP	20371350
MIRT485599	hsa-miR-7111-5p	PAR-CLIP	20371350
MIRT485598	hsa-miR-4525	PAR-CLIP	20371350
MIRT485597	hsa-miR-5010-5p	PAR-CLIP	20371350
MIRT485596	hsa-miR-92a-2-5p	PAR-CLIP	20371350
MIRT485595	hsa-miR-4447	PAR-CLIP	20371350
MIRT485593	hsa-miR-4472	PAR-CLIP	20371350
MIRT485594	hsa-miR-1275	PAR-CLIP	20371350
MIRT485592	hsa-miR-4665-5p	PAR-CLIP	20371350
MIRT485591	hsa-miR-7109-5p	PAR-CLIP	20371350
MIRT485617	hsa-miR-1207-3p	PAR-CLIP	20371350
MIRT485616	hsa-miR-6786-5p	PAR-CLIP	20371350
MIRT485615	hsa-miR-3179	PAR-CLIP	20371350
MIRT485614	hsa-miR-3150b-3p	PAR-CLIP	20371350
MIRT485613	hsa-miR-4784	PAR-CLIP	20371350
MIRT485612	hsa-miR-3202	PAR-CLIP	20371350
MIRT485611	hsa-miR-765	PAR-CLIP	20371350
MIRT485609	hsa-miR-4747-5p	PAR-CLIP	20371350
MIRT485610	hsa-miR-5196-5p	PAR-CLIP	20371350
MIRT485608	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT485607	hsa-miR-4271	PAR-CLIP	20371350
MIRT485606	hsa-miR-4725-3p	PAR-CLIP	20371350
MIRT485605	hsa-miR-6780b-5p	PAR-CLIP	20371350
MIRT485604	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT485602	hsa-miR-625-5p	PAR-CLIP	20371350
MIRT485603	hsa-miR-4723-5p	PAR-CLIP	20371350
MIRT485601	hsa-miR-5698	PAR-CLIP	20371350
MIRT485600	hsa-miR-6870-5p	PAR-CLIP	20371350
MIRT485599	hsa-miR-7111-5p	PAR-CLIP	20371350
MIRT485598	hsa-miR-4525	PAR-CLIP	20371350
MIRT485597	hsa-miR-5010-5p	PAR-CLIP	20371350
MIRT485596	hsa-miR-92a-2-5p	PAR-CLIP	20371350
MIRT485595	hsa-miR-4447	PAR-CLIP	20371350
MIRT485593	hsa-miR-4472	PAR-CLIP	20371350
MIRT485594	hsa-miR-1275	PAR-CLIP	20371350
MIRT485592	hsa-miR-4665-5p	PAR-CLIP	20371350
MIRT485591	hsa-miR-7109-5p	PAR-CLIP	20371350
MIRT485617	hsa-miR-1207-3p	PAR-CLIP	23592263
MIRT485616	hsa-miR-6786-5p	PAR-CLIP	23592263
MIRT485615	hsa-miR-3179	PAR-CLIP	23592263
MIRT485614	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT485613	hsa-miR-4784	PAR-CLIP	23592263
MIRT485612	hsa-miR-3202	PAR-CLIP	23592263
MIRT485611	hsa-miR-765	PAR-CLIP	23592263
MIRT485609	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT485610	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT485608	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT485607	hsa-miR-4271	PAR-CLIP	23592263
MIRT485606	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT485605	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT485604	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT485602	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT485603	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT485601	hsa-miR-5698	PAR-CLIP	23592263
MIRT485600	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT485599	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT485598	hsa-miR-4525	PAR-CLIP	23592263
MIRT485597	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT485596	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT485595	hsa-miR-4447	PAR-CLIP	23592263
MIRT485593	hsa-miR-4472	PAR-CLIP	23592263
MIRT485594	hsa-miR-1275	PAR-CLIP	23592263
MIRT485592	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT485591	hsa-miR-7109-5p	PAR-CLIP	23592263
MIRT485617	hsa-miR-1207-3p	PAR-CLIP	23592263
MIRT485616	hsa-miR-6786-5p	PAR-CLIP	23592263
MIRT485615	hsa-miR-3179	PAR-CLIP	23592263
MIRT485614	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT485613	hsa-miR-4784	PAR-CLIP	23592263
MIRT485612	hsa-miR-3202	PAR-CLIP	23592263
MIRT485611	hsa-miR-765	PAR-CLIP	23592263
MIRT485609	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT485610	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT485608	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT485607	hsa-miR-4271	PAR-CLIP	23592263
MIRT485606	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT485605	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT485604	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT485602	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT485603	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT485601	hsa-miR-5698	PAR-CLIP	23592263
MIRT485600	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT485599	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT485598	hsa-miR-4525	PAR-CLIP	23592263
MIRT485597	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT485596	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT485595	hsa-miR-4447	PAR-CLIP	23592263
MIRT485593	hsa-miR-4472	PAR-CLIP	23592263
MIRT485594	hsa-miR-1275	PAR-CLIP	23592263
MIRT485592	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT485591	hsa-miR-7109-5p	PAR-CLIP	23592263
MIRT1001149	hsa-miR-1245	CLIP-seq
MIRT1001150	hsa-miR-1253	CLIP-seq
MIRT1001151	hsa-miR-1283	CLIP-seq
MIRT1001152	hsa-miR-1287	CLIP-seq
MIRT1001153	hsa-miR-1296	CLIP-seq
MIRT1001154	hsa-miR-130a	CLIP-seq
MIRT1001155	hsa-miR-130b	CLIP-seq
MIRT1001156	hsa-miR-149	CLIP-seq
MIRT1001157	hsa-miR-185	CLIP-seq
MIRT1001158	hsa-miR-19a	CLIP-seq
MIRT1001159	hsa-miR-19b	CLIP-seq
MIRT1001160	hsa-miR-218	CLIP-seq
MIRT1001161	hsa-miR-301a	CLIP-seq
MIRT1001162	hsa-miR-301b	CLIP-seq
MIRT1001163	hsa-miR-3135b	CLIP-seq
MIRT1001164	hsa-miR-3185	CLIP-seq
MIRT1001165	hsa-miR-320e	CLIP-seq
MIRT1001166	hsa-miR-338-5p	CLIP-seq
MIRT1001167	hsa-miR-34a	CLIP-seq
MIRT1001168	hsa-miR-3591-5p	CLIP-seq
MIRT1001169	hsa-miR-3611	CLIP-seq
MIRT1001170	hsa-miR-3666	CLIP-seq
MIRT1001171	hsa-miR-3920	CLIP-seq
MIRT1001172	hsa-miR-3921	CLIP-seq
MIRT1001173	hsa-miR-4255	CLIP-seq
MIRT1001174	hsa-miR-4295	CLIP-seq
MIRT1001175	hsa-miR-4318	CLIP-seq
MIRT1001176	hsa-miR-4424	CLIP-seq
MIRT1001177	hsa-miR-4433	CLIP-seq
MIRT1001178	hsa-miR-4434	CLIP-seq
MIRT1001179	hsa-miR-4473	CLIP-seq
MIRT1001180	hsa-miR-449b	CLIP-seq
MIRT1001181	hsa-miR-4516	CLIP-seq
MIRT1001182	hsa-miR-4521	CLIP-seq
MIRT1001183	hsa-miR-454	CLIP-seq
MIRT1001184	hsa-miR-4653-3p	CLIP-seq
MIRT1001185	hsa-miR-4653-5p	CLIP-seq
MIRT1001186	hsa-miR-4671-3p	CLIP-seq
MIRT1001187	hsa-miR-4693-5p	CLIP-seq
MIRT1001188	hsa-miR-4764-5p	CLIP-seq
MIRT1001189	hsa-miR-555	CLIP-seq
MIRT1001190	hsa-miR-571	CLIP-seq
MIRT1001191	hsa-miR-593	CLIP-seq
MIRT1001192	hsa-miR-625	CLIP-seq
MIRT1001193	hsa-miR-644	CLIP-seq
MIRT1001194	hsa-miR-663b	CLIP-seq
MIRT1001195	hsa-miR-760	CLIP-seq
MIRT1001196	hsa-miR-892a	CLIP-seq
MIRT1001167	hsa-miR-34a	CLIP-seq
MIRT1001180	hsa-miR-449b	CLIP-seq
MIRT1996614	hsa-miR-1237	CLIP-seq
MIRT1996615	hsa-miR-3182	CLIP-seq
MIRT1001167	hsa-miR-34a	CLIP-seq
MIRT1996616	hsa-miR-3622a-3p	CLIP-seq
MIRT1996617	hsa-miR-3622b-3p	CLIP-seq
MIRT1996618	hsa-miR-370	CLIP-seq
MIRT1001177	hsa-miR-4433	CLIP-seq
MIRT1001180	hsa-miR-449b	CLIP-seq
MIRT2230628	hsa-miR-1972	CLIP-seq
MIRT2230629	hsa-miR-198	CLIP-seq
MIRT1001167	hsa-miR-34a	CLIP-seq
MIRT1001180	hsa-miR-449b	CLIP-seq
MIRT2230630	hsa-miR-4645-5p	CLIP-seq
MIRT2230631	hsa-miR-4673	CLIP-seq
MIRT2388085	hsa-miR-106a	CLIP-seq
MIRT2388086	hsa-miR-106b	CLIP-seq
MIRT1996614	hsa-miR-1237	CLIP-seq
MIRT1001149	hsa-miR-1245	CLIP-seq
MIRT1001150	hsa-miR-1253	CLIP-seq
MIRT2388087	hsa-miR-1285	CLIP-seq
MIRT2388088	hsa-miR-138	CLIP-seq
MIRT2388089	hsa-miR-17	CLIP-seq
MIRT1001157	hsa-miR-185	CLIP-seq
MIRT2388090	hsa-miR-20a	CLIP-seq
MIRT2388091	hsa-miR-20b	CLIP-seq
MIRT2388092	hsa-miR-3151	CLIP-seq
MIRT1996615	hsa-miR-3182	CLIP-seq
MIRT1001164	hsa-miR-3185	CLIP-seq
MIRT2388093	hsa-miR-3187-5p	CLIP-seq
MIRT1001165	hsa-miR-320e	CLIP-seq
MIRT2388094	hsa-miR-326	CLIP-seq
MIRT2388095	hsa-miR-330-5p	CLIP-seq
MIRT1001166	hsa-miR-338-5p	CLIP-seq
MIRT1001167	hsa-miR-34a	CLIP-seq
MIRT1001168	hsa-miR-3591-5p	CLIP-seq
MIRT2388096	hsa-miR-3609	CLIP-seq
MIRT1001169	hsa-miR-3611	CLIP-seq
MIRT2388097	hsa-miR-378g	CLIP-seq
MIRT1001173	hsa-miR-4255	CLIP-seq
MIRT2388098	hsa-miR-4283	CLIP-seq
MIRT2388099	hsa-miR-4299	CLIP-seq
MIRT1001175	hsa-miR-4318	CLIP-seq
MIRT1001176	hsa-miR-4424	CLIP-seq
MIRT1001177	hsa-miR-4433	CLIP-seq
MIRT1001178	hsa-miR-4434	CLIP-seq
MIRT2388100	hsa-miR-4464	CLIP-seq
MIRT2388101	hsa-miR-4486	CLIP-seq
MIRT2388102	hsa-miR-4489	CLIP-seq
MIRT2388103	hsa-miR-4492	CLIP-seq
MIRT2388104	hsa-miR-4498	CLIP-seq
MIRT1001180	hsa-miR-449b	CLIP-seq
MIRT1001181	hsa-miR-4516	CLIP-seq
MIRT2388105	hsa-miR-4531	CLIP-seq
MIRT1001187	hsa-miR-4693-5p	CLIP-seq
MIRT2388106	hsa-miR-4710	CLIP-seq
MIRT2388107	hsa-miR-4748	CLIP-seq
MIRT2388108	hsa-miR-4792	CLIP-seq
MIRT2388109	hsa-miR-4796-3p	CLIP-seq
MIRT2388110	hsa-miR-498	CLIP-seq
MIRT2388111	hsa-miR-519d	CLIP-seq
MIRT2388112	hsa-miR-548ah	CLIP-seq
MIRT1001189	hsa-miR-555	CLIP-seq
MIRT1001191	hsa-miR-593	CLIP-seq
MIRT2388113	hsa-miR-612	CLIP-seq
MIRT1001193	hsa-miR-644	CLIP-seq
MIRT1001194	hsa-miR-663b	CLIP-seq
MIRT2388114	hsa-miR-762	CLIP-seq
MIRT2388115	hsa-miR-877	CLIP-seq
MIRT1001196	hsa-miR-892a	CLIP-seq
MIRT2388116	hsa-miR-93	CLIP-seq
MIRT1996614	hsa-miR-1237	CLIP-seq
MIRT1996615	hsa-miR-3182	CLIP-seq
MIRT1001166	hsa-miR-338-5p	CLIP-seq
MIRT1001177	hsa-miR-4433	CLIP-seq
MIRT2429000	hsa-miR-622	CLIP-seq
MIRT2388115	hsa-miR-877	CLIP-seq
MIRT1996614	hsa-miR-1237	CLIP-seq
MIRT1996615	hsa-miR-3182	CLIP-seq
MIRT1001177	hsa-miR-4433	CLIP-seq
MIRT1001154	hsa-miR-130a	CLIP-seq
MIRT1001155	hsa-miR-130b	CLIP-seq
MIRT1001158	hsa-miR-19a	CLIP-seq
MIRT1001159	hsa-miR-19b	CLIP-seq
MIRT1001160	hsa-miR-218	CLIP-seq
MIRT1001161	hsa-miR-301a	CLIP-seq
MIRT1001162	hsa-miR-301b	CLIP-seq
MIRT2534707	hsa-miR-3153	CLIP-seq
MIRT1001168	hsa-miR-3591-5p	CLIP-seq
MIRT1001170	hsa-miR-3666	CLIP-seq
MIRT1001171	hsa-miR-3920	CLIP-seq
MIRT1001172	hsa-miR-3921	CLIP-seq
MIRT2534708	hsa-miR-4267	CLIP-seq
MIRT1001174	hsa-miR-4295	CLIP-seq
MIRT1001179	hsa-miR-4473	CLIP-seq
MIRT1001183	hsa-miR-454	CLIP-seq
MIRT1001185	hsa-miR-4653-5p	CLIP-seq
MIRT2534709	hsa-miR-4668-5p	CLIP-seq
MIRT1001186	hsa-miR-4671-3p	CLIP-seq
MIRT2534710	hsa-miR-4719	CLIP-seq
MIRT1001191	hsa-miR-593	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ELK1	Activation	15806162
FOSL2	Activation	13679379
JUN	Activation	13679379;15806162
JUND	Activation	13679379
NR1I2	Activation	21072196
RBMX	Repression	16707624
SRF	Activation	15806162

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	21673316
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001701	Process	In utero embryonic development	IEA
GO:0002224	Process	Toll-like receptor signaling pathway	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	10918580
GO:0005515	Function	Protein binding	IPI	16189514, 19060904, 20511396, 21516116, 21988832, 23661758, 24029232, 25416956, 26258633, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	23661758, 28186491
GO:0005634	Component	Nucleus	TAS	10918580
GO:0005654	Component	Nucleoplasm	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	23661758, 28186491
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	10918580
GO:0006935	Process	Chemotaxis	TAS	10918580
GO:0006954	Process	Inflammatory response	IEA
GO:0006968	Process	Cellular defense response	TAS	10918580
GO:0007296	Process	Vitellogenesis	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	8230424
GO:0009611	Process	Response to wounding	IEA
GO:0009615	Process	Response to virus	TAS	8230424
GO:0010467	Process	Gene expression	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0060674	Process	Placenta blood vessel development	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	23661758, 28186491
GO:0140467	Process	Integrated stress response signaling	NAS	28566324
GO:1902895	Process	Positive regulation of miRNA transcription	IDA	21673316
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA
GO:1990841	Function	Promoter-specific chromatin binding	IEA
GO:2000144	Process	Positive regulation of DNA-templated transcription initiation	IDA	23027619

Other IDs

• MIM: 136515
• HGNC: 13718
• e!Ensembl: ENSG00000175592

Protein

• UniProt ID: P15407
• Protein name: Fos-related antigen 1 (FRA-1)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00170	bZIP_1	103 → 166	bZIP transcription factor	Coiled-coil

• Sequence:

  MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLG
  PSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAA
  KCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKE
  GDTGSTSGTSSPPAPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPST
  PEPCASAHRKSSSSSGDPSSDPLGSPTLLAL

• Sequence length: 271

Pathways

KEGG:

Wnt signaling pathway
Osteoclast differentiation
IL-17 signaling pathway
Human T-cell leukemia virus 1 infection

Reactome:

NGF-stimulated transcription

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	12209953, 25971554, 29112457		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	12209953		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	16002475, 29112457		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	11106247		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	22411068		★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	BEFREE	11106247		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	24807963, 29864419		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	30990796		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	22461694, 26646719		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	35169275	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma, Aspirin-Induced	Asthma	BEFREE	26646719		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	LHGDN	18172271		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	27229157	Stimulate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	26646719		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	30324710		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	29326694		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	34267747	Associate	★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	20647332		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	20647332	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	16615118, 21822309		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15608675, 17192200, 17254320, 20511396, 22586064, 23001043, 23483055, 24073962, 25200076, 25301070, 25666264, 25828376, 26646695, 27816489, 28411283, 29382358, 30816904, 31612408		★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast Diseases	BEFREE	17192200, 17254320		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17192200, 19687301, 20511396, 22286759, 23301044, 24073962, 25200076, 25666264, 27388253, 27857161, 29273624, 29382358, 32692442, 34907034, 37480115, 37971884	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17254320, 26943581	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	18827820, 21969367, 22286759, 26191275, 26581505, 28169308, 40598282	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11106247, 16199154, 23873024, 24073962		★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	21371080	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	21371080, 23301044	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	26191275	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28653890, 31274473	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	21371080	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	16615118, 21822309		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	18288638, 26549498, 27328938, 29112457, 29155362, 30344941		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	19585555, 21647742, 23880844, 25971554, 36716407, 38282564, 39631181	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	24807963, 28430580	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32305558	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21969367, 22547449	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26943581	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	24771263	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	18854825, 23880844, 25971554		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30892941		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	15514944, 19640172, 25651840		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	15514944, 24604526, 25651840		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	33887357	Stimulate	★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	25489966		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	29914371	Stimulate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22198213, 26646695, 29399696, 31602273		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	11751871		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24658684, 25750173, 26975631, 29399696, 29915160, 30804456		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21572402, 24658684, 25697897, 25750173, 26056802, 29135090, 29399696, 33934428, 36931635	Associate	★☆☆☆☆ Found in Text Mining only
Deficiency of glucose-6-phosphate dehydrogenase	Deficiency Of Glucose-6-Phosphate Dehydrogenase	BEFREE	2316520		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	29135090	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29135090		★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	16504044	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	26191275	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	40344965	Associate	★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	26274503	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	25971554		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	22028113	Associate	★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	17192200		★☆☆☆☆ Found in Text Mining only
Fibromatosis	Fibromatosis	BEFREE	22411068		★☆☆☆☆ Found in Text Mining only
Fibromuscular Dysplasia	Fibromuscular Dysplasia	BEFREE	29544690		★☆☆☆☆ Found in Text Mining only
Folate Malabsorption Hereditary	Hereditary folate malabsorption	Pubtator	21930702	Associate	★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	11106247		★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	2316520, 8074164		★☆☆☆☆ Found in Text Mining only
FRONTOMETAPHYSEAL DYSPLASIA 1	Frontometaphyseal Dysplasia	BEFREE	29544690		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	30935763		★☆☆☆☆ Found in Text Mining only
Gestational trophoblastic disease	Hydatidiform mole	BEFREE	15968203		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	15831677, 22609303		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	15831677, 21088499, 30572904, 34282187, 34399888, 35292358, 35351656, 40598282	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	11778649, 15831677, 21088499, 22609303, 30572904		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	15831677		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	15831677, 35292358, 37642779	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28232512, 30572904		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	24652774, 31392215	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	31274473	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	8962164	Inhibit	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	17192200, 21371080	Associate	★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	28572589		★☆☆☆☆ Found in Text Mining only
Idiopathic Membranous Glomerulonephritis	Membranous Glomerulonephritis	BEFREE	29243784		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	37561311	Associate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	24652774, 31392215		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	29257201		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	2018070, 6218753, 7069746	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	2316520		★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	Pubtator	29899195	Associate	★☆☆☆☆ Found in Text Mining only
Lipid Metabolism Disorders	Lipid Metabolism Disorders	BEFREE	28356106		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28653890, 31274473		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	29703138	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	18288638		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	18288638	Associate	★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	BEFREE	23983265		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22028113	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25750173, 27388253, 33794365	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	30303565		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	15831677		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11431356, 15608675, 20511396, 21673316, 22586064, 23001043, 23483055, 24073962, 25200076, 25301070, 25666264, 25828376, 26646695, 27816489, 28411283, 29382358, 29384218, 30816904, 31612408		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	18288638, 26549498, 27328938, 29112457, 29155362, 30344941		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	18854825		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28220783, 30618127		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12692267, 12727841, 26337460, 30575900		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26330014, 28169308, 30935763		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	16615118, 21822309		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	1466570, 15514944, 17192200, 19653276, 21822309, 22286759, 22586064, 25381818, 26330014, 27144339, 27816489, 29384218, 30344941, 30497369, 30935763, 31300541, 31672492		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	15514944, 25651840		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22198213, 26646695, 29399696, 31602273		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11562178, 23831570, 27816489, 30816904, 31275861		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15608675		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	14519134, 35926467	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	20663135, 30089785		★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	29243784		★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	2316520		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	17872495		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	18096084	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	18096084	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	28678424		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	8074164		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	16045542	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Facioscapulohumeral	Facioscapulohumeral Muscular Dystrophy	BEFREE	29544690		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	29807388		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	29807388	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	25958199, 31665243		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	25958199	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	35484574	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	29070520	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12209953, 12692267, 16002475, 16045542, 17254320, 17572495, 17872495, 18288638, 18435914, 21822309, 22028113, 22411068, 22586064, 22911824, 24042169, 24073962, 24830720, 24993594, 25381818, 25666264, 25750173, 26734995, 27626695, 27685628, 28220783, 28481878, 28653890, 29382358, 30262588, 30935763, 31244935, 31274473, 31565483, 31612408		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	26734995		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	24411941		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24993594		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	21514551	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	22286759, 25666264		★☆☆☆☆ Found in Text Mining only
Osteoarthritis Hip	Osteoarthritis	Pubtator	38200556	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	36672268	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	30779858		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	25815782	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	29620143	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30471098		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	39631181	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	18854825		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19585555, 21647742, 23144806, 29662190, 36402875, 38282564, 38447347, 39596024	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19617914	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28220783, 30618127		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	10217407, 15714138, 19435822	Associate	★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	28841122	Associate	★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	11559656		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12692267, 12727841, 26337460, 30575900		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26337460, 30575900	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	25175497, 30318470, 30825251		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	16504044, 25489966		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	22911824		★☆☆☆☆ Found in Text Mining only
Pyogenic Arthritis, Pyoderma Gangrenosum and Acne	Pyogenic Arthritis, Pyoderma Gangrenosum And Acne	BEFREE	3209055		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	30990796		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	30990796		★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	40344965	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	34969953	Associate	★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	16045542	Associate	★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	26602520	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22547449, 23633675, 27144339, 28790303, 31612408		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	11489794, 22028113, 27882471, 28645305		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	16045542, 28790303, 38032139	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33794365	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	16045542		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	28572589		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26330014, 28169308, 30935763		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	11925593, 28169308, 30266078, 37415737	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	11590908	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	9690519		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	11106247		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	11590908	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	11106247		★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	Pubtator	36641423	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24029232, 24830720, 28604765, 29273624, 29384218, 30155754, 31015574, 31300541, 31672492		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24029232, 29273624, 31300541, 33533919, 33652085, 39523372	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	29914371		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	BEFREE	17192200		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24771263, 32271412, 38172584	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	15514944	Inhibit	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25081683, 33456361	Associate	★☆☆☆☆ Found in Text Mining only