Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	80381
Gene name	CD276 molecule
Gene symbol	CD276
Synonyms (NCBI Gene)	4Ig-B7-H3B7-H3B7H3B7RP-2
Chromosome	15
Chromosome location	15q24.1
Summary	The protein encoded by this gene belongs to the immunoglobulin superfamily, and thought to participate in the regulation of T-cell-mediated immune response. Studies show that while the transcript of this gene is ubiquitously expressed in normal tissues an

243

Show/Hide all (243)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003343	hsa-miR-29a-3p	Review	20026422
MIRT004631	hsa-miR-29c-3p	Review	20026422
MIRT003343	hsa-miR-29a-3p	Luciferase reporter assayWestern blot	19584290
MIRT003343	hsa-miR-29a-3p	Luciferase reporter assayWestern blot	19584290
MIRT018004	hsa-miR-335-5p	Microarray	18185580
MIRT052388	hsa-let-7a-5p	CLASH	23622248
MIRT050009	hsa-miR-28-5p	CLASH	23622248
MIRT049416	hsa-miR-92a-3p	CLASH	23622248
MIRT039444	hsa-miR-421	CLASH	23622248
MIRT036011	hsa-miR-1301-3p	CLASH	23622248
MIRT052669	hsa-miR-1260b	CLASH	23622248
MIRT004631	hsa-miR-29c-3p	MicroarrayqRT-PCR	24590289
MIRT438714	hsa-miR-187-3p	Luciferase reporter assayqRT-PCR	23916610
MIRT438714	hsa-miR-187-3p	Luciferase reporter assayqRT-PCR	23916610
MIRT003343	hsa-miR-29a-3p	PAR-CLIP	26701625
MIRT004631	hsa-miR-29c-3p	PAR-CLIP	26701625
MIRT734596	hsa-miR-2909	Luciferase reporter assayWestern blotting	33676551
MIRT874453	hsa-let-7a	CLIP-seq
MIRT874454	hsa-let-7b	CLIP-seq
MIRT874455	hsa-let-7c	CLIP-seq
MIRT874456	hsa-let-7d	CLIP-seq
MIRT874457	hsa-let-7e	CLIP-seq
MIRT874458	hsa-let-7f	CLIP-seq
MIRT874459	hsa-let-7g	CLIP-seq
MIRT874460	hsa-let-7i	CLIP-seq
MIRT874461	hsa-miR-1207-5p	CLIP-seq
MIRT874462	hsa-miR-1294	CLIP-seq
MIRT874463	hsa-miR-1909	CLIP-seq
MIRT874464	hsa-miR-202	CLIP-seq
MIRT874465	hsa-miR-2392	CLIP-seq
MIRT874466	hsa-miR-2467-3p	CLIP-seq
MIRT874467	hsa-miR-3150a-3p	CLIP-seq
MIRT874468	hsa-miR-3158-5p	CLIP-seq
MIRT874469	hsa-miR-3175	CLIP-seq
MIRT874470	hsa-miR-3184	CLIP-seq
MIRT874471	hsa-miR-3605-5p	CLIP-seq
MIRT874472	hsa-miR-3678-3p	CLIP-seq
MIRT874473	hsa-miR-423-5p	CLIP-seq
MIRT874474	hsa-miR-4418	CLIP-seq
MIRT874475	hsa-miR-4458	CLIP-seq
MIRT874476	hsa-miR-4500	CLIP-seq
MIRT874477	hsa-miR-4505	CLIP-seq
MIRT874478	hsa-miR-4640-5p	CLIP-seq
MIRT874479	hsa-miR-4688	CLIP-seq
MIRT874480	hsa-miR-4695-5p	CLIP-seq
MIRT874481	hsa-miR-4710	CLIP-seq
MIRT874482	hsa-miR-4726-5p	CLIP-seq
MIRT874483	hsa-miR-4763-3p	CLIP-seq
MIRT874484	hsa-miR-485-5p	CLIP-seq
MIRT874485	hsa-miR-491-5p	CLIP-seq
MIRT874486	hsa-miR-509-3-5p	CLIP-seq
MIRT874487	hsa-miR-509-5p	CLIP-seq
MIRT874488	hsa-miR-625	CLIP-seq
MIRT874489	hsa-miR-665	CLIP-seq
MIRT874490	hsa-miR-671-5p	CLIP-seq
MIRT874491	hsa-miR-939	CLIP-seq
MIRT874492	hsa-miR-98	CLIP-seq
MIRT874453	hsa-let-7a	CLIP-seq
MIRT874454	hsa-let-7b	CLIP-seq
MIRT874455	hsa-let-7c	CLIP-seq
MIRT874456	hsa-let-7d	CLIP-seq
MIRT874457	hsa-let-7e	CLIP-seq
MIRT874458	hsa-let-7f	CLIP-seq
MIRT874459	hsa-let-7g	CLIP-seq
MIRT874460	hsa-let-7i	CLIP-seq
MIRT874461	hsa-miR-1207-5p	CLIP-seq
MIRT874493	hsa-miR-124	CLIP-seq
MIRT874494	hsa-miR-1253	CLIP-seq
MIRT874495	hsa-miR-1267	CLIP-seq
MIRT874496	hsa-miR-1270	CLIP-seq
MIRT874497	hsa-miR-1275	CLIP-seq
MIRT874498	hsa-miR-128	CLIP-seq
MIRT874499	hsa-miR-1293	CLIP-seq
MIRT874462	hsa-miR-1294	CLIP-seq
MIRT874500	hsa-miR-1321	CLIP-seq
MIRT874501	hsa-miR-148a	CLIP-seq
MIRT874502	hsa-miR-148b	CLIP-seq
MIRT874503	hsa-miR-152	CLIP-seq
MIRT874504	hsa-miR-187	CLIP-seq
MIRT874463	hsa-miR-1909	CLIP-seq
MIRT874505	hsa-miR-1913	CLIP-seq
MIRT874506	hsa-miR-1915	CLIP-seq
MIRT874464	hsa-miR-202	CLIP-seq
MIRT874507	hsa-miR-214	CLIP-seq
MIRT874508	hsa-miR-2278	CLIP-seq
MIRT874509	hsa-miR-27a	CLIP-seq
MIRT874510	hsa-miR-27b	CLIP-seq
MIRT874511	hsa-miR-296-5p	CLIP-seq
MIRT874512	hsa-miR-29a	CLIP-seq
MIRT874513	hsa-miR-29b	CLIP-seq
MIRT874514	hsa-miR-29c	CLIP-seq
MIRT874515	hsa-miR-3120-5p	CLIP-seq
MIRT874516	hsa-miR-3147	CLIP-seq
MIRT874517	hsa-miR-3173-3p	CLIP-seq
MIRT874518	hsa-miR-3185	CLIP-seq
MIRT874519	hsa-miR-3189-5p	CLIP-seq
MIRT874520	hsa-miR-3190	CLIP-seq
MIRT874521	hsa-miR-324-3p	CLIP-seq
MIRT874522	hsa-miR-339-5p	CLIP-seq
MIRT874523	hsa-miR-34c-3p	CLIP-seq
MIRT874524	hsa-miR-3545-5p	CLIP-seq
MIRT874525	hsa-miR-361-3p	CLIP-seq
MIRT874526	hsa-miR-3614-5p	CLIP-seq
MIRT874527	hsa-miR-3619-5p	CLIP-seq
MIRT874528	hsa-miR-3657	CLIP-seq
MIRT874529	hsa-miR-3665	CLIP-seq
MIRT874530	hsa-miR-3714	CLIP-seq
MIRT874531	hsa-miR-3910	CLIP-seq
MIRT874532	hsa-miR-3922-5p	CLIP-seq
MIRT874533	hsa-miR-4251	CLIP-seq
MIRT874534	hsa-miR-4260	CLIP-seq
MIRT874535	hsa-miR-4270	CLIP-seq
MIRT874536	hsa-miR-4284	CLIP-seq
MIRT874537	hsa-miR-4302	CLIP-seq
MIRT874538	hsa-miR-4318	CLIP-seq
MIRT874539	hsa-miR-4329	CLIP-seq
MIRT874540	hsa-miR-4421	CLIP-seq
MIRT874541	hsa-miR-4425	CLIP-seq
MIRT874542	hsa-miR-4434	CLIP-seq
MIRT874543	hsa-miR-4437	CLIP-seq
MIRT874544	hsa-miR-4441	CLIP-seq
MIRT874545	hsa-miR-4446-3p	CLIP-seq
MIRT874475	hsa-miR-4458	CLIP-seq
MIRT874546	hsa-miR-4476	CLIP-seq
MIRT874547	hsa-miR-4477a	CLIP-seq
MIRT874548	hsa-miR-4483	CLIP-seq
MIRT874549	hsa-miR-4488	CLIP-seq
MIRT874476	hsa-miR-4500	CLIP-seq
MIRT874550	hsa-miR-4516	CLIP-seq
MIRT874551	hsa-miR-451b	CLIP-seq
MIRT874552	hsa-miR-4527	CLIP-seq
MIRT874553	hsa-miR-4531	CLIP-seq
MIRT874554	hsa-miR-4533	CLIP-seq
MIRT874555	hsa-miR-4656	CLIP-seq
MIRT874556	hsa-miR-4665-5p	CLIP-seq
MIRT874557	hsa-miR-4668-5p	CLIP-seq
MIRT874558	hsa-miR-4669	CLIP-seq
MIRT874559	hsa-miR-4693-5p	CLIP-seq
MIRT874560	hsa-miR-4697-3p	CLIP-seq
MIRT874561	hsa-miR-4697-5p	CLIP-seq
MIRT874481	hsa-miR-4710	CLIP-seq
MIRT874562	hsa-miR-4711-3p	CLIP-seq
MIRT874563	hsa-miR-4711-5p	CLIP-seq
MIRT874564	hsa-miR-4728-5p	CLIP-seq
MIRT874565	hsa-miR-4739	CLIP-seq
MIRT874566	hsa-miR-4753-5p	CLIP-seq
MIRT874567	hsa-miR-4756-5p	CLIP-seq
MIRT874568	hsa-miR-4758-3p	CLIP-seq
MIRT874483	hsa-miR-4763-3p	CLIP-seq
MIRT874569	hsa-miR-4779	CLIP-seq
MIRT874570	hsa-miR-4790-3p	CLIP-seq
MIRT874571	hsa-miR-506	CLIP-seq
MIRT874572	hsa-miR-511	CLIP-seq
MIRT874573	hsa-miR-539	CLIP-seq
MIRT874574	hsa-miR-541	CLIP-seq
MIRT874575	hsa-miR-548an	CLIP-seq
MIRT874576	hsa-miR-583	CLIP-seq
MIRT874577	hsa-miR-586	CLIP-seq
MIRT874578	hsa-miR-620	CLIP-seq
MIRT874579	hsa-miR-657	CLIP-seq
MIRT874489	hsa-miR-665	CLIP-seq
MIRT874490	hsa-miR-671-5p	CLIP-seq
MIRT874580	hsa-miR-7	CLIP-seq
MIRT874581	hsa-miR-761	CLIP-seq
MIRT874582	hsa-miR-892a	CLIP-seq
MIRT874583	hsa-miR-9	CLIP-seq
MIRT874584	hsa-miR-940	CLIP-seq
MIRT874492	hsa-miR-98	CLIP-seq
MIRT874461	hsa-miR-1207-5p	CLIP-seq
MIRT874493	hsa-miR-124	CLIP-seq
MIRT874530	hsa-miR-3714	CLIP-seq
MIRT874531	hsa-miR-3910	CLIP-seq
MIRT874483	hsa-miR-4763-3p	CLIP-seq
MIRT874571	hsa-miR-506	CLIP-seq
MIRT874461	hsa-miR-1207-5p	CLIP-seq
MIRT874498	hsa-miR-128	CLIP-seq
MIRT874463	hsa-miR-1909	CLIP-seq
MIRT874535	hsa-miR-4270	CLIP-seq
MIRT874544	hsa-miR-4441	CLIP-seq
MIRT1959278	hsa-miR-4514	CLIP-seq
MIRT1959279	hsa-miR-4645-5p	CLIP-seq
MIRT1959280	hsa-miR-4673	CLIP-seq
MIRT1959281	hsa-miR-4692	CLIP-seq
MIRT1959282	hsa-miR-4703-3p	CLIP-seq
MIRT1959283	hsa-miR-4755-3p	CLIP-seq
MIRT874483	hsa-miR-4763-3p	CLIP-seq
MIRT874584	hsa-miR-940	CLIP-seq
MIRT2196309	hsa-miR-1179	CLIP-seq
MIRT2196310	hsa-miR-188-3p	CLIP-seq
MIRT874530	hsa-miR-3714	CLIP-seq
MIRT2196311	hsa-miR-4422	CLIP-seq
MIRT874461	hsa-miR-1207-5p	CLIP-seq
MIRT874499	hsa-miR-1293	CLIP-seq
MIRT874463	hsa-miR-1909	CLIP-seq
MIRT874505	hsa-miR-1913	CLIP-seq
MIRT874507	hsa-miR-214	CLIP-seq
MIRT874518	hsa-miR-3185	CLIP-seq
MIRT874519	hsa-miR-3189-5p	CLIP-seq
MIRT874520	hsa-miR-3190	CLIP-seq
MIRT874521	hsa-miR-324-3p	CLIP-seq
MIRT874523	hsa-miR-34c-3p	CLIP-seq
MIRT874527	hsa-miR-3619-5p	CLIP-seq
MIRT874529	hsa-miR-3665	CLIP-seq
MIRT874530	hsa-miR-3714	CLIP-seq
MIRT874545	hsa-miR-4446-3p	CLIP-seq
MIRT874548	hsa-miR-4483	CLIP-seq
MIRT874555	hsa-miR-4656	CLIP-seq
MIRT874568	hsa-miR-4758-3p	CLIP-seq
MIRT874483	hsa-miR-4763-3p	CLIP-seq
MIRT874575	hsa-miR-548an	CLIP-seq
MIRT874579	hsa-miR-657	CLIP-seq
MIRT874490	hsa-miR-671-5p	CLIP-seq
MIRT874580	hsa-miR-7	CLIP-seq
MIRT874581	hsa-miR-761	CLIP-seq
MIRT874499	hsa-miR-1293	CLIP-seq
MIRT874518	hsa-miR-3185	CLIP-seq
MIRT874548	hsa-miR-4483	CLIP-seq
MIRT874580	hsa-miR-7	CLIP-seq
MIRT2499329	hsa-miR-1178	CLIP-seq
MIRT874494	hsa-miR-1253	CLIP-seq
MIRT874506	hsa-miR-1915	CLIP-seq
MIRT874466	hsa-miR-2467-3p	CLIP-seq
MIRT874511	hsa-miR-296-5p	CLIP-seq
MIRT2499330	hsa-miR-3126-5p	CLIP-seq
MIRT2499331	hsa-miR-3137	CLIP-seq
MIRT874519	hsa-miR-3189-5p	CLIP-seq
MIRT874525	hsa-miR-361-3p	CLIP-seq
MIRT874530	hsa-miR-3714	CLIP-seq
MIRT2499332	hsa-miR-3913-3p	CLIP-seq
MIRT1959282	hsa-miR-4703-3p	CLIP-seq
MIRT874570	hsa-miR-4790-3p	CLIP-seq
MIRT2499333	hsa-miR-489	CLIP-seq
MIRT874576	hsa-miR-583	CLIP-seq
MIRT2499329	hsa-miR-1178	CLIP-seq
MIRT874506	hsa-miR-1915	CLIP-seq
MIRT874511	hsa-miR-296-5p	CLIP-seq
MIRT2499331	hsa-miR-3137	CLIP-seq
MIRT874519	hsa-miR-3189-5p	CLIP-seq
MIRT874525	hsa-miR-361-3p	CLIP-seq
MIRT2499332	hsa-miR-3913-3p	CLIP-seq
MIRT1959282	hsa-miR-4703-3p	CLIP-seq
MIRT874570	hsa-miR-4790-3p	CLIP-seq
MIRT2499333	hsa-miR-489	CLIP-seq

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001817	Process	Regulation of cytokine production	IBA
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005102	Function	Signaling receptor binding	NAS	11224528
GO:0005515	Function	Protein binding	IPI	18650384
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	NAS	15188059
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	15188059
GO:0032649	Process	Regulation of type II interferon production	IEA
GO:0032729	Process	Positive regulation of type II interferon production	IDA	11224528
GO:0042102	Process	Positive regulation of T cell proliferation	IDA	11224528
GO:0042102	Process	Positive regulation of T cell proliferation	IEA
GO:0042110	Process	T cell activation	IDA	18650384
GO:0042110	Process	T cell activation	IEA
GO:0050776	Process	Regulation of immune response	NAS	11224528
GO:0050852	Process	T cell receptor signaling pathway	IBA

MIM	HGNC	e!Ensembl
605715	19137	ENSG00000103855

Q5ZPR3

Protein name

CD276 antigen (4Ig-B7-H3) (B7 homolog 3) (B7-H3) (Costimulatory molecule) (CD antigen CD276)

Protein function

May participate in the regulation of T-cell-mediated immune response. May play a protective role in tumor cells by inhibiting natural-killer mediated cell lysis as well as a role of marker for detection of neuroblastoma cells. May be involved in

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	32 → 138	Immunoglobulin V-set domain	Domain
PF13927	Ig_3	144 → 224		Domain
PF07686	V-set	250 → 356	Immunoglobulin V-set domain	Domain
PF13927	Ig_3	362 → 442		Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous but not detectable in peripheral blood lymphocytes or granulocytes. Weakly expressed in resting monocytes. Expressed in dendritic cells derived from monocytes. Expressed in epithelial cells of sinonasal tissue. Expressed in

Sequence

MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSL
AQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSF
TCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQD
GQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQ
RSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEG
RDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPY
SKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLF
DVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIAL
LVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA

Sequence length

534

Interactions

View interactions

	KEGG
	Cell adhesion molecules

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (15)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSLEXIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Long QT syndrome	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (199)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute leukemia	Leukemia	BEFREE	25130683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	20844808, 29526824, 30513627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28024695, 30127617, 31737785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	28386362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	31998416, 34194394	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Craniopharyngioma	Craniopharyngioma	BEFREE	31043272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	31382461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aicardi Syndrome	Aicardi syndrome	Pubtator	31998416	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	25567370		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29413459, 30664982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	17323353, 26702052	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	26065426, 26108069, 28094276, 30075787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	30075787	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	25931383, 26065426, 28685773, 31113935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	21784485		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28382144, 30253078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	30655315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	35443752	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	35876221, 37528722	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Stem Glioma	Brain Stem Glioma	BEFREE	23232807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18690846, 21518725, 24577056, 26771843, 28529630, 29344150, 29712688, 30082909, 30226585, 31082216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24562936, 24577056, 28537889, 31292534, 32602545, 33782032, 33932112, 34018684, 34265738, 36423363, 36901916, 37643511, 37648771, 39367484, 39735676, 40393975 View all (1 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24892449, 35384874	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29924389, 30813210, 35920698, 37974070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	28539467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22729558, 24194851, 30942404, 32544882, 34104078, 34603293, 37861541	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	34588590	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	30808776	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28382144, 29725402, 30253078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	27939887, 27960166, 28024695, 30089601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	31892360	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	20976171	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	35862858, 38364961	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	18694993, 24885059, 25089268, 32166404, 32322590, 34081621, 36894965, 39614178, 39621555, 40428825	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	29484464, 32322590, 38182561	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28104527, 28765941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	30027617		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	28627681, 30087701, 30099052		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	30087701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	28627681, 30087701, 30099052		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	31382461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	31060912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	31060912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	35145510	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	31013360		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	30879172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	20140740, 20333377, 22473715, 23098490, 30128047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	23098490	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20333377, 22473715, 24630518, 24892449, 25684945, 26151358, 26787540, 27145365, 27329595, 28676400, 29113264, 29115601, 29710520, 29871819, 30131660, 30952834, 31424670 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20333377, 23098490, 25139714, 25684945, 26787540, 30131660, 32363121, 32514163, 32719950, 33011740, 37661645	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24892449, 31424670	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	30481143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	30328478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29180874, 31440091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	30328478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	BEFREE	31043272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	32958683, 37870091	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	23474948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Desmoplastic small round cell tumor	Pubtator	18613926, 32703985	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	32787907	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30081105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Intrinsic Pontine Glioma	Diffuse Intrinsic Pontine Glioma	BEFREE	23232807, 29914796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Early infantile epileptic encephalopathy with suppression bursts	Epileptic Encephalopathy	BEFREE	27644254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	35804040, 37159818	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	27764786	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	35752862	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	31060912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	27874953, 36159808	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	25120098, 30813210		★★★★★ ★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	33889438	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Neoplasms	Gestational Trophoblastic Neoplasms	BEFREE	31013360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	31060912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22080438, 24892449, 30914782, 31075138, 31466914, 31485480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24892449, 31075138, 34168003, 34565408, 36474171, 36717836, 37770968	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22080438, 24892449, 30914782, 31075138, 31466914, 31485480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30027617, 30377558, 30914782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30027617	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	31113935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	19501877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	30725359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	35140722	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	26376842, 31267380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	31044564, 32602545	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	39735676	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	36093941	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	36685583	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31106564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	38203769	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	37070487	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	29696716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile Pilocytic Astrocytoma	Astrocytoma	BEFREE	23232807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	39621555	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Large cell carcinoma of lung	Lung Carcinoma	BEFREE	20844808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	36361619	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	25130683, 26376842, 34562306, 34787059, 36361619, 37070487	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	26376842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16217749, 24787022, 28243980, 29344257, 30942404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	16217749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	31044564	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	27960166, 28539467, 32633367, 35443752, 38124403	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	31292886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	31292886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	31113935, 31292886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	31292886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25609202, 34417325	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	29725402, 30132557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	32633367, 36525343, 39621555	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	37870091	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	31060912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Central Nervous System Neoplasm	Malignant neoplasm of the central nervous system	BEFREE	24013874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	23232807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	25872657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	21792917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18690846, 21518725, 24577056, 26771843, 28529630, 29344150, 29712688, 30082909, 30226585, 31082216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	31213832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27939887, 27960166, 28024695, 30089601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28104527, 28765941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19844235, 20035626, 23242015, 29996538, 30664982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20971039, 21784485, 23634795, 27801901, 30614027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	30614027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25120098, 29069741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28382144, 30253078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16217749, 19844235, 20333377, 21518725, 21671471, 22080438, 22473715, 23232807, 23242015, 24013874, 24892449, 25120098, 25872657, 26151358, 26771843 View all (29 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	28627681, 30087701, 30099052		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	20140740, 20333377, 22473715, 30128047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	25872657, 30553455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	18613926, 32145124, 32992699, 34988920, 35876221, 36825029, 40269882	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	31382461		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	18690846, 21378130, 23474948, 30706335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	23474948, 33925968, 35940046	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	23474948	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	30546952, 31629137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	36203966	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	30808776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	21792917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	28513992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	34289871	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	26438868	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	30573782, 31060912, 31731055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	22996270, 26065426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	33730109	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	18975328	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18625675, 18690846, 19584290, 19844235, 20035626, 20333377, 20844808, 21344157, 21518725, 21671471, 21792917, 22080438, 22473715, 23242015, 24013874 View all (56 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	LHGDN	15314238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	18613926, 23232807, 24069378, 28866709, 33795387, 35852863, 37130627	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	24069378, 28866709, 31481583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	23232807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumors	Neuroectodermal Tumors	BEFREE	23232807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	20844808, 25609202, 26149216, 27960166, 28539467, 29530936, 31737785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	31714284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Opitz GBBB Syndrome, X-Linked	Opitz GBBB Syndrome, X-Linked	BEFREE	27644254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	35941227	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	18690846, 27644254, 30123093, 30524885, 31060912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	23940627, 27644254, 31950059, 35312779, 36320072, 36519392	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	28765941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	31892360	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28104527, 28765941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	20495537, 34290311, 37800814	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19844235, 20035626, 23242015, 29088829, 29996538, 30664982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	29413459, 29996538, 30664982, 30753824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	23242015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	20035626, 35219310, 35624419, 37974070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	18373702	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	BEFREE	30486739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Ciliary Dyskinesia	Ciliary dyskinesia	BEFREE	26108069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20971039, 21784485, 23634795, 27801901, 30614027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17686830, 18042703, 18829542, 19276267, 27801901, 32581061, 34417325, 35333400, 36114082, 36245088, 36481650, 37452083, 37967200, 40615466	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	30614027		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31106564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	31213832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	18694993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31440091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	32576886	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	18975328	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Alveolar	Rhabdomyosarcoma	Pubtator	34552155	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	18292521, 25931383, 26065426, 31292886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	18292521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	36275693	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	36983005	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	31412888	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	30850021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	30850021	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	20844808, 21344157, 29526824, 31737114, 31737785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26438868, 31089395, 32548602, 32959211, 35115487, 35941227, 36268020, 38096229	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	34675936, 36983005	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	29484464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28401653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	21344157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25120098, 29069741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	16489649, 21251161, 32025206, 33669921, 34459388, 37488673	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30813210	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	34680929	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	37373167	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	35574031, 36120433, 36525343	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	35574031	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35384874	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	36869048	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33306717, 33845814, 35563359, 35751046, 36175880	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	29924389, 34848831, 35942212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CD276 (CD276 molecule)