Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8038
Gene name	ADAM metallopeptidase domain 12
Gene symbol	ADAM12
Synonyms (NCBI Gene)	ADAM12-OT1CAR10MCMPMCMPMltnaMLTNMLTNA
Chromosome	10
Chromosome location	10q26.2
Summary	This gene encodes a member of a family of proteins that are structurally related to snake venom disintegrins and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle de

240

Show/Hide all (240)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005667	hsa-miR-29b-3p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCR	20971881
MIRT005667	hsa-miR-29b-3p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCR	20971881
MIRT005667	hsa-miR-29b-3p	Luciferase reporter assayMicroarrayqRT-PCR	19956414
MIRT023733	hsa-miR-1-3p	Microarray	18668037
MIRT441266	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT441266	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT005667	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCRWestern blot	25886595
MIRT765913	hsa-miR-1266	CLIP-seq
MIRT765914	hsa-miR-188-3p	CLIP-seq
MIRT765915	hsa-miR-2964a-5p	CLIP-seq
MIRT765916	hsa-miR-3591-3p	CLIP-seq
MIRT765917	hsa-miR-4476	CLIP-seq
MIRT765918	hsa-miR-4518	CLIP-seq
MIRT765919	hsa-miR-4677-3p	CLIP-seq
MIRT765920	hsa-miR-4679	CLIP-seq
MIRT765921	hsa-miR-548n	CLIP-seq
MIRT765922	hsa-miR-562	CLIP-seq
MIRT765923	hsa-miR-600	CLIP-seq
MIRT765924	hsa-miR-103a	CLIP-seq
MIRT765925	hsa-miR-107	CLIP-seq
MIRT765926	hsa-miR-1184	CLIP-seq
MIRT765927	hsa-miR-1205	CLIP-seq
MIRT765928	hsa-miR-1208	CLIP-seq
MIRT765929	hsa-miR-15a	CLIP-seq
MIRT765930	hsa-miR-15b	CLIP-seq
MIRT765931	hsa-miR-16	CLIP-seq
MIRT765932	hsa-miR-195	CLIP-seq
MIRT765933	hsa-miR-3158-5p	CLIP-seq
MIRT765934	hsa-miR-3166	CLIP-seq
MIRT765935	hsa-miR-424	CLIP-seq
MIRT765936	hsa-miR-4325	CLIP-seq
MIRT765937	hsa-miR-452	CLIP-seq
MIRT765938	hsa-miR-4676-3p	CLIP-seq
MIRT765939	hsa-miR-4771	CLIP-seq
MIRT765940	hsa-miR-497	CLIP-seq
MIRT765941	hsa-miR-544	CLIP-seq
MIRT1545080	hsa-miR-1207-3p	CLIP-seq
MIRT1545081	hsa-miR-1275	CLIP-seq
MIRT1545082	hsa-miR-1288	CLIP-seq
MIRT1545083	hsa-miR-3120-5p	CLIP-seq
MIRT1545084	hsa-miR-3160-5p	CLIP-seq
MIRT1545085	hsa-miR-3199	CLIP-seq
MIRT1545086	hsa-miR-323b-3p	CLIP-seq
MIRT1545087	hsa-miR-374a	CLIP-seq
MIRT1545088	hsa-miR-374b	CLIP-seq
MIRT1545089	hsa-miR-4259	CLIP-seq
MIRT1545090	hsa-miR-4443	CLIP-seq
MIRT1545091	hsa-miR-4525	CLIP-seq
MIRT1545092	hsa-miR-4652-5p	CLIP-seq
MIRT1545093	hsa-miR-4665-5p	CLIP-seq
MIRT1545094	hsa-miR-4703-3p	CLIP-seq
MIRT1545095	hsa-miR-4715-5p	CLIP-seq
MIRT1545096	hsa-miR-4723-5p	CLIP-seq
MIRT1545097	hsa-miR-4731-5p	CLIP-seq
MIRT1545098	hsa-miR-4753-5p	CLIP-seq
MIRT1545099	hsa-miR-625	CLIP-seq
MIRT1545100	hsa-miR-637	CLIP-seq
MIRT1545101	hsa-miR-765	CLIP-seq
MIRT1925687	hsa-miR-125a-5p	CLIP-seq
MIRT1925688	hsa-miR-125b	CLIP-seq
MIRT1925689	hsa-miR-3918	CLIP-seq
MIRT1925690	hsa-miR-3924	CLIP-seq
MIRT1925691	hsa-miR-4319	CLIP-seq
MIRT1925692	hsa-miR-4512	CLIP-seq
MIRT1925693	hsa-miR-4652-3p	CLIP-seq
MIRT1925694	hsa-miR-4732-3p	CLIP-seq
MIRT1925695	hsa-miR-4766-5p	CLIP-seq
MIRT1925696	hsa-miR-670	CLIP-seq
MIRT2443123	hsa-miR-1200	CLIP-seq
MIRT2443124	hsa-miR-1225-3p	CLIP-seq
MIRT2443125	hsa-miR-1233	CLIP-seq
MIRT2443126	hsa-miR-378	CLIP-seq
MIRT2443127	hsa-miR-378b	CLIP-seq
MIRT2443128	hsa-miR-378c	CLIP-seq
MIRT2443129	hsa-miR-378d	CLIP-seq
MIRT2443130	hsa-miR-378e	CLIP-seq
MIRT2443131	hsa-miR-378f	CLIP-seq
MIRT2443132	hsa-miR-378h	CLIP-seq
MIRT2443133	hsa-miR-378i	CLIP-seq
MIRT2443134	hsa-miR-422a	CLIP-seq
MIRT2443135	hsa-miR-4324	CLIP-seq
MIRT2443136	hsa-miR-4667-3p	CLIP-seq
MIRT2443137	hsa-miR-4740-3p	CLIP-seq
MIRT2443138	hsa-miR-544b	CLIP-seq
MIRT2443139	hsa-miR-617	CLIP-seq
MIRT2469532	hsa-miR-1178	CLIP-seq
MIRT2469533	hsa-miR-1229	CLIP-seq
MIRT2469534	hsa-miR-1263	CLIP-seq
MIRT765913	hsa-miR-1266	CLIP-seq
MIRT2469535	hsa-miR-1273g	CLIP-seq
MIRT2469536	hsa-miR-1279	CLIP-seq
MIRT2469537	hsa-miR-128	CLIP-seq
MIRT2469538	hsa-miR-139-5p	CLIP-seq
MIRT2469539	hsa-miR-145	CLIP-seq
MIRT2469540	hsa-miR-149	CLIP-seq
MIRT765914	hsa-miR-188-3p	CLIP-seq
MIRT2469541	hsa-miR-200b	CLIP-seq
MIRT2469542	hsa-miR-200c	CLIP-seq
MIRT2469543	hsa-miR-2113	CLIP-seq
MIRT2469544	hsa-miR-2116	CLIP-seq
MIRT2469545	hsa-miR-2276	CLIP-seq
MIRT2469546	hsa-miR-27a	CLIP-seq
MIRT2469547	hsa-miR-27b	CLIP-seq
MIRT765915	hsa-miR-2964a-5p	CLIP-seq
MIRT2469548	hsa-miR-3064-5p	CLIP-seq
MIRT2469549	hsa-miR-3117-5p	CLIP-seq
MIRT1545083	hsa-miR-3120-5p	CLIP-seq
MIRT2469550	hsa-miR-3127-3p	CLIP-seq
MIRT2469551	hsa-miR-3140-3p	CLIP-seq
MIRT2469552	hsa-miR-3150a-5p	CLIP-seq
MIRT2469553	hsa-miR-3150b-5p	CLIP-seq
MIRT2469554	hsa-miR-3156-5p	CLIP-seq
MIRT2469555	hsa-miR-346	CLIP-seq
MIRT2469556	hsa-miR-3650	CLIP-seq
MIRT2469557	hsa-miR-3973	CLIP-seq
MIRT2469558	hsa-miR-4255	CLIP-seq
MIRT2469559	hsa-miR-4288	CLIP-seq
MIRT2469560	hsa-miR-429	CLIP-seq
MIRT2469561	hsa-miR-4307	CLIP-seq
MIRT2469562	hsa-miR-4328	CLIP-seq
MIRT2469563	hsa-miR-4421	CLIP-seq
MIRT2469564	hsa-miR-4474-3p	CLIP-seq
MIRT2469565	hsa-miR-4475	CLIP-seq
MIRT765918	hsa-miR-4518	CLIP-seq
MIRT2469566	hsa-miR-4522	CLIP-seq
MIRT1925693	hsa-miR-4652-3p	CLIP-seq
MIRT2469567	hsa-miR-4668-3p	CLIP-seq
MIRT765919	hsa-miR-4677-3p	CLIP-seq
MIRT2469568	hsa-miR-4677-5p	CLIP-seq
MIRT765920	hsa-miR-4679	CLIP-seq
MIRT2469569	hsa-miR-4726-3p	CLIP-seq
MIRT2469570	hsa-miR-4772-3p	CLIP-seq
MIRT2469571	hsa-miR-4775	CLIP-seq
MIRT2469572	hsa-miR-4794	CLIP-seq
MIRT2469573	hsa-miR-520g	CLIP-seq
MIRT2469574	hsa-miR-520h	CLIP-seq
MIRT2469575	hsa-miR-548c-3p	CLIP-seq
MIRT765921	hsa-miR-548n	CLIP-seq
MIRT2469576	hsa-miR-548t	CLIP-seq
MIRT2469577	hsa-miR-582-5p	CLIP-seq
MIRT2469578	hsa-miR-632	CLIP-seq
MIRT2469579	hsa-miR-644	CLIP-seq
MIRT2469580	hsa-miR-889	CLIP-seq
MIRT2469532	hsa-miR-1178	CLIP-seq
MIRT1545080	hsa-miR-1207-3p	CLIP-seq
MIRT2469534	hsa-miR-1263	CLIP-seq
MIRT765913	hsa-miR-1266	CLIP-seq
MIRT2469535	hsa-miR-1273g	CLIP-seq
MIRT1545081	hsa-miR-1275	CLIP-seq
MIRT2469536	hsa-miR-1279	CLIP-seq
MIRT2469537	hsa-miR-128	CLIP-seq
MIRT1545082	hsa-miR-1288	CLIP-seq
MIRT2469538	hsa-miR-139-5p	CLIP-seq
MIRT2469539	hsa-miR-145	CLIP-seq
MIRT2469540	hsa-miR-149	CLIP-seq
MIRT765914	hsa-miR-188-3p	CLIP-seq
MIRT2674374	hsa-miR-1976	CLIP-seq
MIRT2469541	hsa-miR-200b	CLIP-seq
MIRT2469542	hsa-miR-200c	CLIP-seq
MIRT2469543	hsa-miR-2113	CLIP-seq
MIRT2469544	hsa-miR-2116	CLIP-seq
MIRT2469545	hsa-miR-2276	CLIP-seq
MIRT2469546	hsa-miR-27a	CLIP-seq
MIRT2469547	hsa-miR-27b	CLIP-seq
MIRT765915	hsa-miR-2964a-5p	CLIP-seq
MIRT2469548	hsa-miR-3064-5p	CLIP-seq
MIRT2469549	hsa-miR-3117-5p	CLIP-seq
MIRT1545083	hsa-miR-3120-5p	CLIP-seq
MIRT2674375	hsa-miR-3121-3p	CLIP-seq
MIRT2469550	hsa-miR-3127-3p	CLIP-seq
MIRT2469551	hsa-miR-3140-3p	CLIP-seq
MIRT2469552	hsa-miR-3150a-5p	CLIP-seq
MIRT2469553	hsa-miR-3150b-5p	CLIP-seq
MIRT2469554	hsa-miR-3156-5p	CLIP-seq
MIRT2674376	hsa-miR-3160-3p	CLIP-seq
MIRT2674377	hsa-miR-3163	CLIP-seq
MIRT1545085	hsa-miR-3199	CLIP-seq
MIRT2674378	hsa-miR-320e	CLIP-seq
MIRT2469555	hsa-miR-346	CLIP-seq
MIRT2469556	hsa-miR-3650	CLIP-seq
MIRT2674379	hsa-miR-3662	CLIP-seq
MIRT2674380	hsa-miR-369-3p	CLIP-seq
MIRT1545087	hsa-miR-374a	CLIP-seq
MIRT1545088	hsa-miR-374b	CLIP-seq
MIRT2674381	hsa-miR-3921	CLIP-seq
MIRT2469557	hsa-miR-3973	CLIP-seq
MIRT2469558	hsa-miR-4255	CLIP-seq
MIRT1545089	hsa-miR-4259	CLIP-seq
MIRT2469559	hsa-miR-4288	CLIP-seq
MIRT2469560	hsa-miR-429	CLIP-seq
MIRT2469561	hsa-miR-4307	CLIP-seq
MIRT2469562	hsa-miR-4328	CLIP-seq
MIRT2469563	hsa-miR-4421	CLIP-seq
MIRT2469564	hsa-miR-4474-3p	CLIP-seq
MIRT2469565	hsa-miR-4475	CLIP-seq
MIRT2674382	hsa-miR-4487	CLIP-seq
MIRT2674383	hsa-miR-4490	CLIP-seq
MIRT2674384	hsa-miR-450b-3p	CLIP-seq
MIRT2674385	hsa-miR-4511	CLIP-seq
MIRT765918	hsa-miR-4518	CLIP-seq
MIRT2469566	hsa-miR-4522	CLIP-seq
MIRT1545091	hsa-miR-4525	CLIP-seq
MIRT1925693	hsa-miR-4652-3p	CLIP-seq
MIRT1545092	hsa-miR-4652-5p	CLIP-seq
MIRT2674386	hsa-miR-4653-5p	CLIP-seq
MIRT1545093	hsa-miR-4665-5p	CLIP-seq
MIRT2469567	hsa-miR-4668-3p	CLIP-seq
MIRT765919	hsa-miR-4677-3p	CLIP-seq
MIRT2469568	hsa-miR-4677-5p	CLIP-seq
MIRT765920	hsa-miR-4679	CLIP-seq
MIRT1545094	hsa-miR-4703-3p	CLIP-seq
MIRT2674387	hsa-miR-4713-3p	CLIP-seq
MIRT1545095	hsa-miR-4715-5p	CLIP-seq
MIRT1545096	hsa-miR-4723-5p	CLIP-seq
MIRT2469569	hsa-miR-4726-3p	CLIP-seq
MIRT1545097	hsa-miR-4731-5p	CLIP-seq
MIRT1925695	hsa-miR-4766-5p	CLIP-seq
MIRT2469570	hsa-miR-4772-3p	CLIP-seq
MIRT2674388	hsa-miR-4774-5p	CLIP-seq
MIRT2469571	hsa-miR-4775	CLIP-seq
MIRT2469572	hsa-miR-4794	CLIP-seq
MIRT2674389	hsa-miR-495	CLIP-seq
MIRT2469573	hsa-miR-520g	CLIP-seq
MIRT2469574	hsa-miR-520h	CLIP-seq
MIRT2674390	hsa-miR-526b	CLIP-seq
MIRT2674391	hsa-miR-548b-3p	CLIP-seq
MIRT2469575	hsa-miR-548c-3p	CLIP-seq
MIRT765921	hsa-miR-548n	CLIP-seq
MIRT2469576	hsa-miR-548t	CLIP-seq
MIRT2674392	hsa-miR-558	CLIP-seq
MIRT2469577	hsa-miR-582-5p	CLIP-seq
MIRT1545099	hsa-miR-625	CLIP-seq
MIRT2469578	hsa-miR-632	CLIP-seq
MIRT1545100	hsa-miR-637	CLIP-seq
MIRT2674393	hsa-miR-638	CLIP-seq
MIRT2469579	hsa-miR-644	CLIP-seq
MIRT2674394	hsa-miR-760	CLIP-seq
MIRT2674395	hsa-miR-769-3p	CLIP-seq
MIRT2469580	hsa-miR-889	CLIP-seq
MIRT2674396	hsa-miR-890	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
SKIL	Repression	20457602

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004222	Function	Metalloendopeptidase activity	IBA
GO:0004222	Function	Metalloendopeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	15574124, 25825872, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005886	Component	Plasma membrane	IDA	15280379
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007520	Process	Myoblast fusion	TAS	7566181
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	TAS	9417060
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0017124	Function	SH3 domain binding	IEA
GO:0017124	Function	SH3 domain binding	IPI	15280379
GO:0045766	Process	Positive regulation of angiogenesis	IMP	28637396
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
602714	190	ENSG00000148848

O43184

Protein name

Disintegrin and metalloproteinase domain-containing protein 12 (ADAM 12) (EC 3.4.24.-) (Meltrin-alpha)

Protein function

Involved in skeletal muscle regeneration, specifically at the onset of cell fusion. Also involved in macrophage-derived giant cells (MGC) and osteoclast formation from mononuclear precursors (By similarity).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01562	Pep_M12B_propep	42 → 167	Reprolysin family propeptide	Family
PF01421	Reprolysin	214 → 416	Reprolysin (M12B) family zinc metalloprotease	Domain
PF00200	Disintegrin	433 → 505	Disintegrin	Domain
PF08516	ADAM_CR	510 → 630	ADAM cysteine-rich	Family

Tissue specificity

TISSUE SPECIFICITY: Isoform 1 is expressed in placenta and skeletal, cardiac, and smooth muscle. Isoform 2 seems to be expressed only in placenta or in embryo and fetus. Both forms were expressed in some tumor cells lines. Not detected in brain, lung, liv

Sequence

MAARPLPVSPARALLLALAGALLAPCEARGVSLWNQGRADEVVSASVGSGDLWIPVKSFD
SKNHPEVLNIRLQRESKELIINLERNEGLIASSFTETHYLQDGTDVSLARNYTVILGHCY
YHGHVRGYSDSAVSLSTCSGLRGLIVFENESYVLEPMKSATNRYKLFPAKKLKSVRGSCG
SHHNTPNLAAKNVFPPPSQTWARRHKRETLKATKYVELVIVADNREFQRQGKDLEKVKQR
LIEIANHVDKFYRPLNIRIVLVGVEVWNDMDKCSVSQDPFTSLHEFLDWRKMKLLPRKSH
DNAQLVSGVYFQGTTIGMAPIMSMCTADQSGGIVMDHSDNPLGAAVTLAHELGHNFGMNH
DTLDRGCSCQMAVEKGGCIMNASTGYPFPMVFSSCSRKDLETSLEKGMGVCLFNLPEVRE
SFGGQKCGNRFVEEGEECDCGEPEECMNRCCNATTCTLKPDAVCAHGLCCEDCQLKPAGT
ACRDSSNSCDLPEFCTGASPHCPANVYLHDGHSCQDVDGYCYNGICQTHEQQCVTLWGPG
AKPAPGICFERVNSAGDPYGNCGKVSKSSFAKCEMRDAKCGKIQCQGGASRPVIGTNAVS
IETNIPLQQGGRILCRGTHVYLGDDMPDPGLVLAGTKCADGKICLNRQCQNISVFGVHEC
AMQCHGRGVCNNRKNCHCEAHWAPPFCDKFGFGGSTDSGPIRQADNQGLTIGILVTILCL
LAAGFVVYLKRKTLIRLLFTNKKTTIEKLRCVRPSRPPRGFQPCQAHLGHLGKGLMRKPP
DSYPPKDNPRRLLQCQNVDISRPLNGLNVPQPQSTQRVLPPLHRAPRAPSVPARPLPAKP
ALRQAQGTCKPNPPQKPLPADPLARTTRLTHALARTPGQWETGLRLAPLRPAPQYPHQVP
RSTHTAYIK

Sequence length

909

Interactions

View interactions

	Reactome
			Invadopodia formation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOGONADISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (120)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	22984426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30617305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	19213876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	17440933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	23324579		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30442938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	23101757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	21173277	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	17088949	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	26553447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	23324579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	23324579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	23101757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	GWASCAT_DG	26184070, 27021288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	12717386, 21240579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	23324579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18241035, 18342566, 21103624, 21387162, 21493715, 21875931, 22662180, 23135915, 24651654, 25886595, 26407179, 28148288, 28765266, 28852196, 29765546, 30042416 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	21240579	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10329602, 16213489, 20688878, 21103624, 21240579, 21387162, 21493715, 22302350, 22662180, 23771733, 24651654, 26407179, 26722530, 35459884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15565459	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12717386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	24499112, 32386517	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35459884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	21617380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35094638, 36717944	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21986939	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	21617380, 25926422, 27685922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	21173277	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	18311789, 30033738	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30746900, 35413826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	17701664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conjunctival Diseases	Conjunctival disease	Pubtator	36398070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	19268722, 19601832, 23491141, 25197389, 25667922, 26875044, 28721062, 28748424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	39501335	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Astrocytoma	Astrocytoma	BEFREE	23324579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	LHGDN	17465398, 18395873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	17701664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	23770704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	21617380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	29476791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	18365756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	29476791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophagitis	Esophagitis	BEFREE	27026568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	30670657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	Pubtator	12456779	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	15509542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	15509542, 29267965	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29267965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29267965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	15509542, 30636076	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	27545300	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	21986939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	21986939	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	21240579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Pancreatitis	Pubtator	23324579	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	23589494	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	39501335	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	23458101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kashin-Beck Disease	Kashin-Beck Disease	BEFREE	27545300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	25268745	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	LHGDN	16139919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	27545300	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	18621736	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	LHGDN	12717386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	16495931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	36099146	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	28395594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	28395594		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	12414501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	21986939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18241035, 18342566, 21103624, 21387162, 21493715, 21501859, 21875931, 22662180, 23135915, 24651654, 25886595, 26407179, 28148288, 28765266, 28852196, 29765546, 30042416 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	29476791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	12717386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25926422, 27685922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30442938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	24798404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15586220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	23135915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18241035, 18342566, 19544357, 19601832, 20688878, 21103624, 21387162, 21875931, 22662180, 23135915, 23324579, 24798404, 28148288, 29476791, 31013576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15381692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	21240579, 21387162, 21493715, 21875931, 25886595, 27554339, 28148288, 28765266		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	23645517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	23645517	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mixed oligoastrocytoma	Oligoastrocytoma	BEFREE	23324579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12456779, 12717386, 19544357, 19601832, 21240579, 21493715, 21875931, 22677901, 23135915, 23324579, 23458101, 23645517, 23686306, 25926422, 27322209 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	30652259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	17653278		★★★★★ ★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	23324579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligodendroglioma	Oligodendroglioma	Pubtator	23324579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	15334463, 19268722, 25197389, 25667922, 29514696	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	16453284, 19268722, 25197389, 25667922	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	19268722, 22284607, 25197389, 25667922, 26875044, 28637509, 28748424, 28929114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	25926422		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	25926422, 27685922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25926422, 27685922	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30442938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	22984426	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31013576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	15574885	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	19213876	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20218926		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	20218926		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Diffuse	Scleroderma	Pubtator	24812288	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	28861129	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	24798404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	26503019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	33761685	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22267082, 24798404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29476791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	21986939, 34587717	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	21986939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stage IV Skin Melanoma	Skin Melanoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15586220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22677901, 34663825, 34686626, 35315496, 36099146, 37847945	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	22926263, 24651654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24651654, 32019179, 39742357	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	31013576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	33387485	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	23324579		★★★★★ ★☆☆☆☆ Found in Text Mining only

ADAM12 (ADAM metallopeptidase domain 12)