Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	80339
Gene name	Patatin like domain 3, 1-acylglycerol-3-phosphate O-acyltransferase
Gene symbol	PNPLA3
Synonyms (NCBI Gene)	ADPNC22orf20iPLA(2)epsilon
Chromosome	22
Chromosome location	22q13.31
Summary	The protein encoded by this gene is a triacylglycerol lipase that mediates triacylglycerol hydrolysis in adipocytes. The encoded protein, which appears to be membrane bound, may be involved in the balance of energy usage/storage in adipocytes. [provided b

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs738409	C>G,T	Risk-factor, likely-benign, drug-response	Coding sequence variant, missense variant, synonymous variant

398

Show/Hide all (398)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016844	hsa-miR-335-5p	Microarray	18185580
MIRT686091	hsa-miR-4438	HITS-CLIP	23313552
MIRT686090	hsa-miR-4687-5p	HITS-CLIP	23313552
MIRT686089	hsa-miR-6504-3p	HITS-CLIP	23313552
MIRT686088	hsa-miR-130b-5p	HITS-CLIP	23313552
MIRT686087	hsa-miR-5095	HITS-CLIP	23313552
MIRT686086	hsa-miR-7151-3p	HITS-CLIP	23313552
MIRT686085	hsa-miR-6807-5p	HITS-CLIP	23313552
MIRT686084	hsa-miR-30a-3p	HITS-CLIP	23313552
MIRT686083	hsa-miR-30d-3p	HITS-CLIP	23313552
MIRT686082	hsa-miR-30e-3p	HITS-CLIP	23313552
MIRT686081	hsa-miR-4763-5p	HITS-CLIP	23313552
MIRT621429	hsa-miR-8062	HITS-CLIP	23824327
MIRT665151	hsa-miR-6513-3p	HITS-CLIP	23824327
MIRT621428	hsa-miR-4308	HITS-CLIP	23824327
MIRT621427	hsa-miR-4292	HITS-CLIP	23824327
MIRT621426	hsa-miR-6791-5p	HITS-CLIP	23824327
MIRT621425	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT621424	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT621423	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT677806	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT677805	hsa-miR-6852-5p	HITS-CLIP	23824327
MIRT677804	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT621422	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT621421	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT621420	hsa-miR-1976	HITS-CLIP	23824327
MIRT621419	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT677803	hsa-miR-23a-5p	HITS-CLIP	23824327
MIRT677802	hsa-miR-23b-5p	HITS-CLIP	23824327
MIRT621418	hsa-miR-656-5p	HITS-CLIP	23824327
MIRT677801	hsa-miR-1297	HITS-CLIP	23824327
MIRT677800	hsa-miR-26a-5p	HITS-CLIP	23824327
MIRT677799	hsa-miR-26b-5p	HITS-CLIP	23824327
MIRT677798	hsa-miR-4465	HITS-CLIP	23824327
MIRT677797	hsa-miR-1343-3p	HITS-CLIP	23824327
MIRT677796	hsa-miR-6783-3p	HITS-CLIP	23824327
MIRT621417	hsa-miR-4279	HITS-CLIP	23824327
MIRT621429	hsa-miR-8062	HITS-CLIP	23824327
MIRT665151	hsa-miR-6513-3p	HITS-CLIP	23824327
MIRT621428	hsa-miR-4308	HITS-CLIP	23824327
MIRT621427	hsa-miR-4292	HITS-CLIP	23824327
MIRT621426	hsa-miR-6791-5p	HITS-CLIP	23824327
MIRT621425	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT621424	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT621423	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT621422	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT621421	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT621420	hsa-miR-1976	HITS-CLIP	23824327
MIRT621419	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT650814	hsa-miR-4731-5p	HITS-CLIP	23824327
MIRT650813	hsa-miR-5589-5p	HITS-CLIP	23824327
MIRT621418	hsa-miR-656-5p	HITS-CLIP	23824327
MIRT621417	hsa-miR-4279	HITS-CLIP	23824327
MIRT621429	hsa-miR-8062	HITS-CLIP	23824327
MIRT621428	hsa-miR-4308	HITS-CLIP	23824327
MIRT621427	hsa-miR-4292	HITS-CLIP	23824327
MIRT621426	hsa-miR-6791-5p	HITS-CLIP	23824327
MIRT621425	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT621424	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT621423	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT621422	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT621421	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT621420	hsa-miR-1976	HITS-CLIP	23824327
MIRT621419	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT650814	hsa-miR-4731-5p	HITS-CLIP	23824327
MIRT650813	hsa-miR-5589-5p	HITS-CLIP	23824327
MIRT621418	hsa-miR-656-5p	HITS-CLIP	23824327
MIRT621417	hsa-miR-4279	HITS-CLIP	23824327
MIRT621429	hsa-miR-8062	HITS-CLIP	23824327
MIRT621428	hsa-miR-4308	HITS-CLIP	23824327
MIRT621427	hsa-miR-4292	HITS-CLIP	23824327
MIRT621426	hsa-miR-6791-5p	HITS-CLIP	23824327
MIRT621425	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT621424	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT621423	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT621422	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT621421	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT621420	hsa-miR-1976	HITS-CLIP	23824327
MIRT621419	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT621418	hsa-miR-656-5p	HITS-CLIP	23824327
MIRT621417	hsa-miR-4279	HITS-CLIP	23824327
MIRT630117	hsa-miR-6813-3p	HITS-CLIP	23824327
MIRT630116	hsa-miR-520g-3p	HITS-CLIP	23824327
MIRT630115	hsa-miR-520h	HITS-CLIP	23824327
MIRT630114	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT630113	hsa-miR-212-5p	HITS-CLIP	23824327
MIRT630112	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT630111	hsa-miR-4769-3p	HITS-CLIP	23824327
MIRT630110	hsa-miR-6817-5p	HITS-CLIP	23824327
MIRT630109	hsa-miR-5189-3p	HITS-CLIP	23824327
MIRT630108	hsa-miR-4757-5p	HITS-CLIP	23824327
MIRT630107	hsa-miR-6744-3p	HITS-CLIP	23824327
MIRT630106	hsa-miR-4727-5p	HITS-CLIP	23824327
MIRT630105	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT621429	hsa-miR-8062	HITS-CLIP	23824327
MIRT621428	hsa-miR-4308	HITS-CLIP	23824327
MIRT621427	hsa-miR-4292	HITS-CLIP	23824327
MIRT621426	hsa-miR-6791-5p	HITS-CLIP	23824327
MIRT621425	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT621424	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT621423	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT621422	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT621421	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT621420	hsa-miR-1976	HITS-CLIP	23824327
MIRT621419	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT621418	hsa-miR-656-5p	HITS-CLIP	23824327
MIRT621417	hsa-miR-4279	HITS-CLIP	23824327
MIRT519493	hsa-miR-590-3p	PAR-CLIP	23446348
MIRT519492	hsa-miR-4524b-3p	PAR-CLIP	23446348
MIRT519482	hsa-miR-411-5p	PAR-CLIP	23446348
MIRT519491	hsa-miR-1228-3p	PAR-CLIP	23446348
MIRT519490	hsa-miR-6765-3p	PAR-CLIP	23446348
MIRT519489	hsa-miR-6823-5p	PAR-CLIP	23446348
MIRT519488	hsa-miR-4735-5p	PAR-CLIP	23446348
MIRT519487	hsa-miR-4794	PAR-CLIP	23446348
MIRT519486	hsa-miR-664a-5p	PAR-CLIP	23446348
MIRT519485	hsa-miR-4524a-3p	PAR-CLIP	23446348
MIRT519484	hsa-miR-6832-5p	PAR-CLIP	23446348
MIRT519483	hsa-miR-4775	PAR-CLIP	23446348
MIRT519482	hsa-miR-411-5p	PAR-CLIP	23446348
MIRT519481	hsa-miR-197-3p	PAR-CLIP	23446348
MIRT519480	hsa-miR-5096	PAR-CLIP	23446348
MIRT519479	hsa-miR-2113	PAR-CLIP	23446348
MIRT519478	hsa-miR-5010-3p	PAR-CLIP	23446348
MIRT519477	hsa-miR-4701-5p	PAR-CLIP	23446348
MIRT686091	hsa-miR-4438	HITS-CLIP	23313552
MIRT686090	hsa-miR-4687-5p	HITS-CLIP	23313552
MIRT686089	hsa-miR-6504-3p	HITS-CLIP	23313552
MIRT686088	hsa-miR-130b-5p	HITS-CLIP	23313552
MIRT686087	hsa-miR-5095	HITS-CLIP	23313552
MIRT686086	hsa-miR-7151-3p	HITS-CLIP	23313552
MIRT686085	hsa-miR-6807-5p	HITS-CLIP	23313552
MIRT686084	hsa-miR-30a-3p	HITS-CLIP	23313552
MIRT686083	hsa-miR-30d-3p	HITS-CLIP	23313552
MIRT686082	hsa-miR-30e-3p	HITS-CLIP	23313552
MIRT686081	hsa-miR-4763-5p	HITS-CLIP	23313552
MIRT621429	hsa-miR-8062	HITS-CLIP	23824327
MIRT665151	hsa-miR-6513-3p	HITS-CLIP	23824327
MIRT621428	hsa-miR-4308	HITS-CLIP	23824327
MIRT621427	hsa-miR-4292	HITS-CLIP	23824327
MIRT621426	hsa-miR-6791-5p	HITS-CLIP	23824327
MIRT621425	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT621424	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT621423	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT677806	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT677805	hsa-miR-6852-5p	HITS-CLIP	23824327
MIRT677804	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT621422	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT621421	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT621420	hsa-miR-1976	HITS-CLIP	23824327
MIRT621419	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT677803	hsa-miR-23a-5p	HITS-CLIP	23824327
MIRT677802	hsa-miR-23b-5p	HITS-CLIP	23824327
MIRT621418	hsa-miR-656-5p	HITS-CLIP	23824327
MIRT677801	hsa-miR-1297	HITS-CLIP	23824327
MIRT677800	hsa-miR-26a-5p	HITS-CLIP	23824327
MIRT677799	hsa-miR-26b-5p	HITS-CLIP	23824327
MIRT677798	hsa-miR-4465	HITS-CLIP	23824327
MIRT677797	hsa-miR-1343-3p	HITS-CLIP	23824327
MIRT677796	hsa-miR-6783-3p	HITS-CLIP	23824327
MIRT621417	hsa-miR-4279	HITS-CLIP	23824327
MIRT621429	hsa-miR-8062	HITS-CLIP	23824327
MIRT665151	hsa-miR-6513-3p	HITS-CLIP	23824327
MIRT621428	hsa-miR-4308	HITS-CLIP	23824327
MIRT621427	hsa-miR-4292	HITS-CLIP	23824327
MIRT621426	hsa-miR-6791-5p	HITS-CLIP	23824327
MIRT621425	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT621424	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT621423	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT621422	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT621421	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT621420	hsa-miR-1976	HITS-CLIP	23824327
MIRT621419	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT650814	hsa-miR-4731-5p	HITS-CLIP	23824327
MIRT650813	hsa-miR-5589-5p	HITS-CLIP	23824327
MIRT621418	hsa-miR-656-5p	HITS-CLIP	23824327
MIRT621417	hsa-miR-4279	HITS-CLIP	23824327
MIRT621429	hsa-miR-8062	HITS-CLIP	23824327
MIRT621428	hsa-miR-4308	HITS-CLIP	23824327
MIRT621427	hsa-miR-4292	HITS-CLIP	23824327
MIRT621426	hsa-miR-6791-5p	HITS-CLIP	23824327
MIRT621425	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT621424	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT621423	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT621422	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT621421	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT621420	hsa-miR-1976	HITS-CLIP	23824327
MIRT621419	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT650814	hsa-miR-4731-5p	HITS-CLIP	23824327
MIRT650813	hsa-miR-5589-5p	HITS-CLIP	23824327
MIRT621418	hsa-miR-656-5p	HITS-CLIP	23824327
MIRT621417	hsa-miR-4279	HITS-CLIP	23824327
MIRT621429	hsa-miR-8062	HITS-CLIP	23824327
MIRT621428	hsa-miR-4308	HITS-CLIP	23824327
MIRT621427	hsa-miR-4292	HITS-CLIP	23824327
MIRT621426	hsa-miR-6791-5p	HITS-CLIP	23824327
MIRT621425	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT621424	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT621423	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT621422	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT621421	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT621420	hsa-miR-1976	HITS-CLIP	23824327
MIRT621419	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT621418	hsa-miR-656-5p	HITS-CLIP	23824327
MIRT621417	hsa-miR-4279	HITS-CLIP	23824327
MIRT630117	hsa-miR-6813-3p	HITS-CLIP	23824327
MIRT630116	hsa-miR-520g-3p	HITS-CLIP	23824327
MIRT630115	hsa-miR-520h	HITS-CLIP	23824327
MIRT630114	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT630113	hsa-miR-212-5p	HITS-CLIP	23824327
MIRT630112	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT630111	hsa-miR-4769-3p	HITS-CLIP	23824327
MIRT630110	hsa-miR-6817-5p	HITS-CLIP	23824327
MIRT630109	hsa-miR-5189-3p	HITS-CLIP	23824327
MIRT630108	hsa-miR-4757-5p	HITS-CLIP	23824327
MIRT630107	hsa-miR-6744-3p	HITS-CLIP	23824327
MIRT630106	hsa-miR-4727-5p	HITS-CLIP	23824327
MIRT630105	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT621429	hsa-miR-8062	HITS-CLIP	23824327
MIRT621428	hsa-miR-4308	HITS-CLIP	23824327
MIRT621427	hsa-miR-4292	HITS-CLIP	23824327
MIRT621426	hsa-miR-6791-5p	HITS-CLIP	23824327
MIRT621425	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT621424	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT621423	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT621422	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT621421	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT621420	hsa-miR-1976	HITS-CLIP	23824327
MIRT621419	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT621418	hsa-miR-656-5p	HITS-CLIP	23824327
MIRT621417	hsa-miR-4279	HITS-CLIP	23824327
MIRT519493	hsa-miR-590-3p	PAR-CLIP	23446348
MIRT519492	hsa-miR-4524b-3p	PAR-CLIP	23446348
MIRT519482	hsa-miR-411-5p	PAR-CLIP	23446348
MIRT519491	hsa-miR-1228-3p	PAR-CLIP	23446348
MIRT519490	hsa-miR-6765-3p	PAR-CLIP	23446348
MIRT519489	hsa-miR-6823-5p	PAR-CLIP	23446348
MIRT519488	hsa-miR-4735-5p	PAR-CLIP	23446348
MIRT519487	hsa-miR-4794	PAR-CLIP	23446348
MIRT519486	hsa-miR-664a-5p	PAR-CLIP	23446348
MIRT519485	hsa-miR-4524a-3p	PAR-CLIP	23446348
MIRT519484	hsa-miR-6832-5p	PAR-CLIP	23446348
MIRT519483	hsa-miR-4775	PAR-CLIP	23446348
MIRT519482	hsa-miR-411-5p	PAR-CLIP	23446348
MIRT519481	hsa-miR-197-3p	PAR-CLIP	23446348
MIRT519480	hsa-miR-5096	PAR-CLIP	23446348
MIRT519479	hsa-miR-2113	PAR-CLIP	23446348
MIRT519478	hsa-miR-5010-3p	PAR-CLIP	23446348
MIRT519477	hsa-miR-4701-5p	PAR-CLIP	23446348
MIRT1245421	hsa-miR-1343	CLIP-seq
MIRT1245422	hsa-miR-26a	CLIP-seq
MIRT1245423	hsa-miR-26b	CLIP-seq
MIRT1245424	hsa-miR-3614-3p	CLIP-seq
MIRT1245425	hsa-miR-4297	CLIP-seq
MIRT2072603	hsa-miR-1254	CLIP-seq
MIRT2072604	hsa-miR-1257	CLIP-seq
MIRT2072605	hsa-miR-1281	CLIP-seq
MIRT1245421	hsa-miR-1343	CLIP-seq
MIRT2072606	hsa-miR-146b-3p	CLIP-seq
MIRT2072607	hsa-miR-216a	CLIP-seq
MIRT1245422	hsa-miR-26a	CLIP-seq
MIRT1245423	hsa-miR-26b	CLIP-seq
MIRT2072608	hsa-miR-3116	CLIP-seq
MIRT2072609	hsa-miR-3149	CLIP-seq
MIRT2072610	hsa-miR-3173-5p	CLIP-seq
MIRT2072611	hsa-miR-365	CLIP-seq
MIRT2072612	hsa-miR-4656	CLIP-seq
MIRT2072613	hsa-miR-4704-5p	CLIP-seq
MIRT2072614	hsa-miR-4781-3p	CLIP-seq
MIRT2072615	hsa-miR-637	CLIP-seq
MIRT2072616	hsa-miR-661	CLIP-seq
MIRT2072617	hsa-miR-874	CLIP-seq
MIRT2072603	hsa-miR-1254	CLIP-seq
MIRT2072604	hsa-miR-1257	CLIP-seq
MIRT2072605	hsa-miR-1281	CLIP-seq
MIRT1245421	hsa-miR-1343	CLIP-seq
MIRT2072606	hsa-miR-146b-3p	CLIP-seq
MIRT2072607	hsa-miR-216a	CLIP-seq
MIRT1245422	hsa-miR-26a	CLIP-seq
MIRT1245423	hsa-miR-26b	CLIP-seq
MIRT2299761	hsa-miR-28-3p	CLIP-seq
MIRT2072608	hsa-miR-3116	CLIP-seq
MIRT2072610	hsa-miR-3173-5p	CLIP-seq
MIRT1245424	hsa-miR-3614-3p	CLIP-seq
MIRT2072611	hsa-miR-365	CLIP-seq
MIRT2299762	hsa-miR-4637	CLIP-seq
MIRT2072612	hsa-miR-4656	CLIP-seq
MIRT2072613	hsa-miR-4704-5p	CLIP-seq
MIRT2072615	hsa-miR-637	CLIP-seq
MIRT2072616	hsa-miR-661	CLIP-seq
MIRT2072617	hsa-miR-874	CLIP-seq
MIRT2072603	hsa-miR-1254	CLIP-seq
MIRT2072604	hsa-miR-1257	CLIP-seq
MIRT2072606	hsa-miR-146b-3p	CLIP-seq
MIRT2299761	hsa-miR-28-3p	CLIP-seq
MIRT2072608	hsa-miR-3116	CLIP-seq
MIRT2072610	hsa-miR-3173-5p	CLIP-seq
MIRT2072611	hsa-miR-365	CLIP-seq
MIRT2072612	hsa-miR-4656	CLIP-seq
MIRT2072613	hsa-miR-4704-5p	CLIP-seq
MIRT2072615	hsa-miR-637	CLIP-seq
MIRT2072616	hsa-miR-661	CLIP-seq
MIRT2072617	hsa-miR-874	CLIP-seq
MIRT2072605	hsa-miR-1281	CLIP-seq
MIRT1245421	hsa-miR-1343	CLIP-seq
MIRT1245422	hsa-miR-26a	CLIP-seq
MIRT1245423	hsa-miR-26b	CLIP-seq
MIRT1245424	hsa-miR-3614-3p	CLIP-seq
MIRT1245425	hsa-miR-4297	CLIP-seq
MIRT2596446	hsa-miR-1236	CLIP-seq
MIRT2596447	hsa-miR-1260	CLIP-seq
MIRT2596448	hsa-miR-1260b	CLIP-seq
MIRT2072605	hsa-miR-1281	CLIP-seq
MIRT1245421	hsa-miR-1343	CLIP-seq
MIRT2596449	hsa-miR-1470	CLIP-seq
MIRT2596450	hsa-miR-188-3p	CLIP-seq
MIRT2596451	hsa-miR-2110	CLIP-seq
MIRT2596452	hsa-miR-2682	CLIP-seq
MIRT1245422	hsa-miR-26a	CLIP-seq
MIRT1245423	hsa-miR-26b	CLIP-seq
MIRT2596453	hsa-miR-3127-3p	CLIP-seq
MIRT2596454	hsa-miR-3130-3p	CLIP-seq
MIRT2596455	hsa-miR-3144-5p	CLIP-seq
MIRT2072609	hsa-miR-3149	CLIP-seq
MIRT2596456	hsa-miR-3150a-3p	CLIP-seq
MIRT2596457	hsa-miR-3156-3p	CLIP-seq
MIRT2596458	hsa-miR-3191	CLIP-seq
MIRT2596459	hsa-miR-34a	CLIP-seq
MIRT2596460	hsa-miR-34c-5p	CLIP-seq
MIRT1245424	hsa-miR-3614-3p	CLIP-seq
MIRT2596461	hsa-miR-411	CLIP-seq
MIRT2596462	hsa-miR-4271	CLIP-seq
MIRT1245425	hsa-miR-4297	CLIP-seq
MIRT2596463	hsa-miR-449a	CLIP-seq
MIRT2596464	hsa-miR-449b	CLIP-seq
MIRT2596465	hsa-miR-449c	CLIP-seq
MIRT2596466	hsa-miR-450b-3p	CLIP-seq
MIRT2596467	hsa-miR-4514	CLIP-seq
MIRT2596468	hsa-miR-4652-5p	CLIP-seq
MIRT2596469	hsa-miR-4654	CLIP-seq
MIRT2596470	hsa-miR-4667-3p	CLIP-seq
MIRT2596471	hsa-miR-4692	CLIP-seq
MIRT2596472	hsa-miR-4713-3p	CLIP-seq
MIRT2596473	hsa-miR-4725-3p	CLIP-seq
MIRT2596474	hsa-miR-4753-3p	CLIP-seq
MIRT2596475	hsa-miR-4769-5p	CLIP-seq
MIRT2596476	hsa-miR-4795-5p	CLIP-seq
MIRT2596477	hsa-miR-501-3p	CLIP-seq
MIRT2596478	hsa-miR-502-3p	CLIP-seq
MIRT2596479	hsa-miR-635	CLIP-seq
MIRT2596480	hsa-miR-638	CLIP-seq
MIRT2596481	hsa-miR-642a	CLIP-seq
MIRT2596482	hsa-miR-767-5p	CLIP-seq
MIRT2596483	hsa-miR-769-3p	CLIP-seq
MIRT2596446	hsa-miR-1236	CLIP-seq
MIRT2596447	hsa-miR-1260	CLIP-seq
MIRT2596448	hsa-miR-1260b	CLIP-seq
MIRT2072605	hsa-miR-1281	CLIP-seq
MIRT1245421	hsa-miR-1343	CLIP-seq
MIRT2596449	hsa-miR-1470	CLIP-seq
MIRT2596450	hsa-miR-188-3p	CLIP-seq
MIRT2596451	hsa-miR-2110	CLIP-seq
MIRT2596452	hsa-miR-2682	CLIP-seq
MIRT1245422	hsa-miR-26a	CLIP-seq
MIRT1245423	hsa-miR-26b	CLIP-seq
MIRT2596453	hsa-miR-3127-3p	CLIP-seq
MIRT2596454	hsa-miR-3130-3p	CLIP-seq
MIRT2596455	hsa-miR-3144-5p	CLIP-seq
MIRT2072609	hsa-miR-3149	CLIP-seq
MIRT2596456	hsa-miR-3150a-3p	CLIP-seq
MIRT2596457	hsa-miR-3156-3p	CLIP-seq
MIRT2596458	hsa-miR-3191	CLIP-seq
MIRT2596459	hsa-miR-34a	CLIP-seq
MIRT2596460	hsa-miR-34c-5p	CLIP-seq
MIRT1245424	hsa-miR-3614-3p	CLIP-seq
MIRT2596462	hsa-miR-4271	CLIP-seq
MIRT1245425	hsa-miR-4297	CLIP-seq
MIRT2596463	hsa-miR-449a	CLIP-seq
MIRT2596464	hsa-miR-449b	CLIP-seq
MIRT2596465	hsa-miR-449c	CLIP-seq
MIRT2596466	hsa-miR-450b-3p	CLIP-seq
MIRT2596467	hsa-miR-4514	CLIP-seq
MIRT2596468	hsa-miR-4652-5p	CLIP-seq
MIRT2596469	hsa-miR-4654	CLIP-seq
MIRT2596470	hsa-miR-4667-3p	CLIP-seq
MIRT2596471	hsa-miR-4692	CLIP-seq
MIRT2596472	hsa-miR-4713-3p	CLIP-seq
MIRT2596473	hsa-miR-4725-3p	CLIP-seq
MIRT2596474	hsa-miR-4753-3p	CLIP-seq
MIRT2596475	hsa-miR-4769-5p	CLIP-seq
MIRT2596476	hsa-miR-4795-5p	CLIP-seq
MIRT2596477	hsa-miR-501-3p	CLIP-seq
MIRT2596478	hsa-miR-502-3p	CLIP-seq
MIRT2596479	hsa-miR-635	CLIP-seq
MIRT2596480	hsa-miR-638	CLIP-seq
MIRT2596481	hsa-miR-642a	CLIP-seq
MIRT2596482	hsa-miR-767-5p	CLIP-seq
MIRT2596483	hsa-miR-769-3p	CLIP-seq

Show/Hide all (50)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001676	Process	Long-chain fatty acid metabolic process	IDA	22560221
GO:0001676	Process	Long-chain fatty acid metabolic process	IEA
GO:0003841	Function	1-acylglycerol-3-phosphate O-acyltransferase activity	IDA	22560221
GO:0003841	Function	1-acylglycerol-3-phosphate O-acyltransferase activity	IEA
GO:0004465	Function	Lipoprotein lipase activity	TAS
GO:0004623	Function	Phospholipase A2 activity	IDA	15364929
GO:0004623	Function	Phospholipase A2 activity	IEA
GO:0004806	Function	Triacylglycerol lipase activity	IBA
GO:0004806	Function	Triacylglycerol lipase activity	IDA	15364929, 20034933, 22560221
GO:0004806	Function	Triacylglycerol lipase activity	IEA
GO:0004806	Function	Triacylglycerol lipase activity	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005811	Component	Lipid droplet	IBA
GO:0005811	Component	Lipid droplet	IDA	20034933, 22560221, 23398201
GO:0005811	Component	Lipid droplet	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006650	Process	Glycerophospholipid metabolic process	IDA	22560221
GO:0006654	Process	Phosphatidic acid biosynthetic process	IDA	22560221
GO:0006654	Process	Phosphatidic acid biosynthetic process	IEA
GO:0008654	Process	Phospholipid biosynthetic process	IEA
GO:0009744	Process	Response to sucrose	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IDA	22560221
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	ISS
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016411	Function	Acylglycerol O-acyltransferase activity	TAS
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019432	Process	Triglyceride biosynthetic process	IDA	15364929, 22560221
GO:0019432	Process	Triglyceride biosynthetic process	IEA
GO:0019433	Process	Triglyceride catabolic process	IBA
GO:0019433	Process	Triglyceride catabolic process	IDA	15364929, 22560221
GO:0019433	Process	Triglyceride catabolic process	IEA
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0034389	Process	Lipid droplet organization	IMP	23398201
GO:0035727	Function	Lysophosphatidic acid binding	IDA	22560221
GO:0035727	Function	Lysophosphatidic acid binding	IEA
GO:0036042	Function	Long-chain fatty acyl-CoA binding	IDA	22560221
GO:0036042	Function	Long-chain fatty acyl-CoA binding	IEA
GO:0036153	Process	Triglyceride acyl-chain remodeling	IDA	24511104
GO:0036155	Process	Acylglycerol acyl-chain remodeling	TAS
GO:0042171	Function	Lysophosphatidic acid acyltransferase activity	IDA	22560221
GO:0050872	Process	White fat cell differentiation	IEA
GO:0051264	Function	Mono-olein transacylation activity	IDA	15364929
GO:0051265	Function	Diolein transacylation activity	IDA	15364929
GO:0055088	Process	Lipid homeostasis	IBA
GO:1905243	Process	Cellular response to 3,3',5-triiodo-L-thyronine	IEA

MIM	HGNC	e!Ensembl
609567	18590	ENSG00000100344

Q9NST1

Protein name

1-acylglycerol-3-phosphate O-acyltransferase PNPLA3 (EC 2.3.1.51) (Acylglycerol transacylase) (Adiponutrin) (ADPN) (Calcium-independent phospholipase A2-epsilon) (iPLA2-epsilon) (EC 3.1.1.4) (Lysophosphatidic acid acyltransferase) (Patatin-like phospholip

Protein function

Specifically catalyzes coenzyme A (CoA)-dependent acylation of 1-acyl-sn-glycerol 3-phosphate (2-lysophosphatidic acid/LPA) to generate phosphatidic acid (PA), an important metabolic intermediate and precursor for both triglycerides and glycerop

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01734	Patatin	10 → 179	Patatin-like phospholipase	Family

Sequence

MYDAERGWSLSFAGCGFLGFYHVGATRCLSEHAPHLLRDARMLFGASAGALHCVGVLSGI
PLEQTLQVLSDLVRKARSRNIGIFHPSFNLSKFLRQGLCKCLPANVHQLISGKIGISLTR
VSDGENVLVSDFRSKDEVVDALVCSCFIPFYSGLIPPSFRGVRYVDGGVSDNVPFIDAKT
TITVSPFYGEYDICPKVKSTNFLHVDITKLSLRLCTGNLYLLSRAFVPPDLKVLGEICLR
GYLDAFRFLEEKGICNRPQPGLKSSSEGMDPEVAMPSWANMSLDSSPESAALAVRLEGDE
LLDHLRLSILPWDESILDTLSPRLATALSEEMKDKGGYMSKICNLLPIRIMSYVMLPCTL
PVESAIAIVQRLVTWLPDMPDDVLWLQWVTSQVFTRVLMCLLPASRSQMPVSSQQASPCT
PEQDWPCWTPCSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKS
L

Sequence length

481

Interactions

View interactions

	KEGG		Reactome
	Glycerolipid metabolism Metabolic pathways		Acyl chain remodeling of DAG and TAG

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (47)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BILIARY TRACT DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLELITHIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CIRRHOSIS OF LIVER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC EYE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIGESTIVE SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL VARICES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER, ALCOHOLIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLSTONES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROENTERITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROINTESTINAL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHAGIC DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatic steatosis	Conflicting classifications of pathogenicity; risk factor	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOCELLULAR CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOGONADISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC APLASTIC ANEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTRAHEPATIC BILE DUCT CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRON METABOLISM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, ALCOHOLIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES, ALCOHOLIC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NAFLD1	Likely benign; Uncertain significance; Benign; Conflicting classifications of pathogenicity; risk factor	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC STEATOHEPATITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL ARTERIAL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PORTAL HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Susceptibility to Nonalcoholic Fatty Liver Disease	Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOCYTOPENIA 4	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (146)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
22q13.3 Deletion Syndrome	22q13.3 deletion syndrome	BEFREE	30308089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	28090653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	21334404, 22869157, 25060292, 25964223, 26676812, 29474507, 30132178, 30161167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	24222094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	21281435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	30327483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	36233078	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asymmetric Septal Hypertrophy	Septal Hypertrophy	BEFREE	26745088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	21281435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	36079710	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	27889599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain infarction	Pubtator	32592869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22087248, 22869157, 22898488, 23776098, 24155878, 24670599, 24763554, 25171251, 25504078, 26219465, 26745088, 26854475, 27888630, 28674415, 28928439 View all (27 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	20684021	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Familial Hypertrophic 1	Cardiomyopathy	Pubtator	30218427	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	26378644, 27128911, 27548720, 28007909, 30174213, 31377187, 31705824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	34798835, 35085396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	24069270, 32592869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	24069270, 26765961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	24069270	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	30189691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	30189691	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	32592869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	24222094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	36454904	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	21893698, 30327483, 30608254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	21893698, 30327483, 30608254		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholestasis of pregnancy	Cholestasis of pregnancy	BEFREE	25297933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30763699, 31519069, 31546054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Liver Failure	Liver failure	BEFREE	31527889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronobiology Disorders	Chronobiology disorder	Pubtator	28695131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	21168459, 21254164, 21319195, 21334404, 21745286, 22087248, 22719190, 22863264, 22978414, 23069476, 23776098, 24081230, 24102786, 24114809, 24155878 View all (24 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	23564580, 25284145, 25986529, 26229402, 29218813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	29083408, 31713012		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	29083408	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	32093693	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	30186434		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Degenerative polyarthritis	Arthritis	BEFREE	30248539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	20373368, 23859071, 25457210, 29396131, 29483677, 30144554, 30186434, 30362098, 30673802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	25646328	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	20373368, 23859071, 25429378, 25457210, 29396131, 29483677, 30144554, 30186434, 30362098, 30673802		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	21665509, 23776098, 23859071, 24069270, 29474507, 32987175, 33348109, 34656649, 35696400, 38360269, 38632349, 39427597	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	23418085	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	21665509, 22724004, 26634513, 35630668, 38145725, 40090039	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	23418085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	19596471, 20826584, 21665509, 21745307, 21756849, 22724004, 24978903, 26337813, 27128911, 27615511, 28303724, 29083408, 29160303, 29509263, 29535416, 30673802, 31377187, 31694082 View all (3 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	29632382		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dyslipidemias	Dyslipidemias	Pubtator	31826069	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
End Stage Liver Disease	End Stage Liver Disease	BEFREE	25273282, 31527889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	LHGDN	18820647		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty Liver	BEFREE	19224197, 19651814, 20480550, 20546964, 20803499, 21178608, 21334404, 21665509, 22093607, 22105854, 22629460, 22898488, 22978414, 23175050, 23416328 View all (46 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty liver	Pubtator	19224197, 19651814, 19738004, 20648472, 20684021, 20803499, 21533024, 21665509, 22087248, 22105854, 22543885, 22546774, 22629460, 22719190, 22724004 View all (85 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty Liver	CTD_human_DG	25678388		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	22258181, 23394097, 23512881, 26599080, 26745088, 26845607, 27128907, 27596100, 28626169, 30487694, 34106646, 34609305, 36166317, 36555467, 36611868, 37298640, 40065199 View all (2 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	20480550, 20803499, 21145868, 22546774, 22560221, 22719876, 22898488, 23023705, 23155331, 23275357, 23418085, 23512881, 24222094, 24445574, 24831885 View all (28 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver Disease	Fatty Liver	GWASDB_DG	23477746		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fibrosis, Liver	Liver Fibrosis	BEFREE	20373368, 21168459, 21745307, 22530607, 22863264, 23418085, 23512881, 24152445, 24445574, 24670599, 24905495, 24978903, 25069572, 25171251, 25278690 View all (24 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	31311600	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	29956823, 37149016	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	22719190, 32680469	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic encephalopathy	Pubtator	34808618	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	28161471, 28776448, 33616244	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	34949757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	32349377, 36881106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	26229402, 28695131, 36233078	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	22543885, 22978414, 24349054, 26389885, 27973562, 30139224, 30218427, 31527889, 31642820, 37400794	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	22898488, 24123231, 24553484, 25171251, 25801076, 26139292, 26389885, 26854475, 28427234, 28797039, 29089161, 30246767, 31642820	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	25678388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	22719190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia	Hyperbilirubinemia	Pubtator	36580335	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	16914601, 22157924, 24828988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	15181042, 18728122, 22471940, 22978414, 27729736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	Pubtator	22471940	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	30771018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	23226254, 40306283	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension Portal	Portal hypertension	Pubtator	26599080, 29150621, 29956823	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	21274868, 23226254	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	23859071	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	19619606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	26355465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	26355465	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	19651814, 21274868, 22724004, 22978414, 23418085, 23859071, 25646328, 25681381, 26962819, 28555633, 28695131, 29055919, 30218427, 30227635, 31826069, 37111057 View all (1 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis of Pregnancy	Intrahepatic cholestasis of pregnancy	Pubtator	25297933	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	26200108, 36947711, 37400794	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	39427597	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	15364929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21319195, 21745286, 22087248, 22704398, 22869157, 22898488, 23333103, 23776098, 24114809, 24155878, 24222094, 24269995, 24445574, 24607626, 24670599 View all (35 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	GWASCAT_DG	29385134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	21168459, 21254164, 21319195, 21334404, 21745286, 22087248, 22560221, 22719190, 22863264, 22978414, 23069476, 23776098, 24081230, 24102786, 24114809 View all (28 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver cirrhosis	Pubtator	23418085, 24152445, 24556216, 24670599, 24978903, 25171251, 26229402, 26389885, 26599080, 27742777, 27973562, 28338112, 29055919, 29258449, 29956823 View all (23 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver Cirrhosis	GWASCAT_DG	23535911		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis Alcoholic	Liver cirrhosis	Pubtator	22087248, 22276112, 24102786, 24114820, 26482880, 28776448, 31630428, 31637480, 32871288, 34656649	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	25297933	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	BEFREE	19946271, 21254164, 22087248, 22276112, 24102786, 24114820, 25060292, 25964223, 26493626, 28776448, 31637480		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	CTD_human_DG	19946271, 26482880		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	GWASCAT_DG	26482880		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Diseases	Liver disease	Pubtator	18940312, 19542081, 22863562, 24155878, 24670599, 24763554, 26219465, 26355465, 26599080, 27752939, 28427234, 29055919, 29562163, 29578593, 30912093 View all (29 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	21893698, 22087248, 22869157, 24155878, 26599080, 29474507, 30161167, 30589442, 30978214, 31630428, 31637480, 33279778	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	19738004, 21281435, 22140488, 22546774, 24152445, 27836992, 27973562, 28776448, 29562163, 30161167, 31527889, 32871288, 33922278, 36924053, 36947711, 37149016, 39312529 View all (2 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	20480550, 31527889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	30802989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	22087248, 24222094, 24269995, 26219465, 26442469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26136587, 29116096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	20648472, 20826584, 26148225, 26765961, 27514759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	24680680, 30161167, 33622266, 36947711, 37400794, 39312529, 40090039	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	29578593, 31826069, 32247823, 32463622, 33622266, 38360269, 39638042	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	20648472, 24417250, 24731669, 24947770, 25429378, 25624712, 25939720, 26978356, 27432073, 27908400, 28303724, 29128053, 30189691, 31826069, 31851849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	24763554, 37298640, 37909034, 38365182	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	27889599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	28007909, 29228164		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	32544194	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
NON RARE IN EUROPE: Non-alcoholic fatty liver disease	Non-Alcoholic Fatty Liver Disease	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	18820647, 19524579, 19542081, 19738004, 19946271, 20015565, 20034933, 20373368, 20648472, 20648474, 20684021, 21168155, 21176169, 21178608, 21281435 View all (202 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	CTD_human_DG	18820647, 24531328, 27180240		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	GWASDB_DG	21423719, 22719876, 23535911		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	GWASCAT_DG	21423719, 22719876, 23535911, 29271184, 29385134, 31311600		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	CTD_human_DG	18820647, 24531328, 27180240		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	20373368, 23418085, 23512881, 24222094, 24445574, 24831885, 25240529, 25791171, 25986529, 26229402, 26305067, 26599080, 27015186, 27128907, 28264426, 30218427, 30772256, 31054980 View all (3 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	GWASCAT_DG	29385134		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	17609260	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	18728122, 19224197, 19390624, 19596471, 21665509, 23334462, 23418085, 23510779, 23859071, 23913731, 24009255, 25250621, 25939720, 26136587, 26305067 View all (13 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	19224197, 19542081, 19729411, 20803499, 22105854, 22140488, 22724004, 23032985, 23226254, 23334462, 23418085, 23512881, 23859071, 24069270, 24477042 View all (16 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	GWASCAT_DG	25246029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	19844213, 22724004, 23418085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	22276112	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	22276112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	19390624, 22140488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	30672430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	37537636	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	BEFREE	26599080, 29956823		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Posterior subcapsular cataract	Capsular cataract	BEFREE	23505555, 30161167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	28090653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	GWASCAT_DG	28090653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	25297933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	23505555, 30161167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pruritus	Pruritus	Pubtator	25297933	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	21319195, 21488075, 22530607, 22898488, 25171251, 25457210, 25801076, 26389885, 26419236, 28797039, 31642820, 31793339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	38360269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	26200108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rosacea	Rosacea	Pubtator	39272052	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spherocytosis Type 1	Spherocytosis	Pubtator	28695131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	19224197, 19651814, 20373368, 20480550, 20546964, 20648472, 20684021, 20803499, 20826584, 21178608, 21236304, 21254164, 21319195, 21334404, 21476920 View all (111 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	CTD_human_DG	25678388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	GWASCAT_DG	29385134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	27627804	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin A Deficiency	Vitamin a deficiency	Pubtator	34063790	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PNPLA3 (patatin like domain 3, 1-acylglycerol-3-phosphate O-acyltransferase)