Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	80332
Gene name	ADAM metallopeptidase domain 33
Gene symbol	ADAM33
Synonyms (NCBI Gene)	C20orf153DJ964F7.1
Chromosome	20
Chromosome location	20p13
Summary	This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes

129

Show/Hide all (129)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019258	hsa-miR-148b-3p	Microarray	17612493
MIRT529187	hsa-miR-8485	PAR-CLIP	22012620
MIRT529185	hsa-miR-6892-3p	PAR-CLIP	22012620
MIRT529186	hsa-miR-2276-5p	PAR-CLIP	22012620
MIRT529184	hsa-miR-642a-5p	PAR-CLIP	22012620
MIRT529183	hsa-miR-6819-3p	PAR-CLIP	22012620
MIRT529187	hsa-miR-8485	PAR-CLIP	22012620
MIRT529185	hsa-miR-6892-3p	PAR-CLIP	22012620
MIRT529186	hsa-miR-2276-5p	PAR-CLIP	22012620
MIRT529184	hsa-miR-642a-5p	PAR-CLIP	22012620
MIRT529183	hsa-miR-6819-3p	PAR-CLIP	22012620
MIRT766167	hsa-miR-1182	CLIP-seq
MIRT766168	hsa-miR-122	CLIP-seq
MIRT766169	hsa-miR-1227	CLIP-seq
MIRT766170	hsa-miR-193a-5p	CLIP-seq
MIRT766171	hsa-miR-2467-3p	CLIP-seq
MIRT766172	hsa-miR-3135b	CLIP-seq
MIRT766173	hsa-miR-3194-3p	CLIP-seq
MIRT766174	hsa-miR-3194-5p	CLIP-seq
MIRT766175	hsa-miR-3652	CLIP-seq
MIRT766176	hsa-miR-3678-3p	CLIP-seq
MIRT766177	hsa-miR-431	CLIP-seq
MIRT766178	hsa-miR-4430	CLIP-seq
MIRT766179	hsa-miR-4715-3p	CLIP-seq
MIRT766180	hsa-miR-4755-3p	CLIP-seq
MIRT766168	hsa-miR-122	CLIP-seq
MIRT766169	hsa-miR-1227	CLIP-seq
MIRT766172	hsa-miR-3135b	CLIP-seq
MIRT766175	hsa-miR-3652	CLIP-seq
MIRT766178	hsa-miR-4430	CLIP-seq
MIRT766179	hsa-miR-4715-3p	CLIP-seq
MIRT766168	hsa-miR-122	CLIP-seq
MIRT1925772	hsa-miR-22	CLIP-seq
MIRT766172	hsa-miR-3135b	CLIP-seq
MIRT1925773	hsa-miR-4274	CLIP-seq
MIRT1925774	hsa-miR-4290	CLIP-seq
MIRT1925775	hsa-miR-4530	CLIP-seq
MIRT766168	hsa-miR-122	CLIP-seq
MIRT766169	hsa-miR-1227	CLIP-seq
MIRT766172	hsa-miR-3135b	CLIP-seq
MIRT766175	hsa-miR-3652	CLIP-seq
MIRT766178	hsa-miR-4430	CLIP-seq
MIRT766179	hsa-miR-4715-3p	CLIP-seq
MIRT766172	hsa-miR-3135b	CLIP-seq
MIRT766167	hsa-miR-1182	CLIP-seq
MIRT766168	hsa-miR-122	CLIP-seq
MIRT766170	hsa-miR-193a-5p	CLIP-seq
MIRT766172	hsa-miR-3135b	CLIP-seq
MIRT766173	hsa-miR-3194-3p	CLIP-seq
MIRT766175	hsa-miR-3652	CLIP-seq
MIRT766177	hsa-miR-431	CLIP-seq
MIRT766178	hsa-miR-4430	CLIP-seq
MIRT766167	hsa-miR-1182	CLIP-seq
MIRT2469687	hsa-miR-1200	CLIP-seq
MIRT766168	hsa-miR-122	CLIP-seq
MIRT766169	hsa-miR-1227	CLIP-seq
MIRT2469688	hsa-miR-1245	CLIP-seq
MIRT2469689	hsa-miR-1245b-5p	CLIP-seq
MIRT766170	hsa-miR-193a-5p	CLIP-seq
MIRT2469690	hsa-miR-1976	CLIP-seq
MIRT766172	hsa-miR-3135b	CLIP-seq
MIRT2469691	hsa-miR-3142	CLIP-seq
MIRT2469692	hsa-miR-3155	CLIP-seq
MIRT2469693	hsa-miR-3155b	CLIP-seq
MIRT2469694	hsa-miR-3157-5p	CLIP-seq
MIRT766173	hsa-miR-3194-3p	CLIP-seq
MIRT2469695	hsa-miR-329	CLIP-seq
MIRT2469696	hsa-miR-3545-3p	CLIP-seq
MIRT2469697	hsa-miR-362-3p	CLIP-seq
MIRT766175	hsa-miR-3652	CLIP-seq
MIRT2469698	hsa-miR-370	CLIP-seq
MIRT2469699	hsa-miR-3941	CLIP-seq
MIRT2469700	hsa-miR-3977	CLIP-seq
MIRT766177	hsa-miR-431	CLIP-seq
MIRT2469701	hsa-miR-4324	CLIP-seq
MIRT2469702	hsa-miR-4418	CLIP-seq
MIRT766178	hsa-miR-4430	CLIP-seq
MIRT2469703	hsa-miR-4468	CLIP-seq
MIRT2469704	hsa-miR-4680-5p	CLIP-seq
MIRT766179	hsa-miR-4715-3p	CLIP-seq
MIRT2469705	hsa-miR-4735-5p	CLIP-seq
MIRT2469706	hsa-miR-4775	CLIP-seq
MIRT2469707	hsa-miR-484	CLIP-seq
MIRT2469708	hsa-miR-509-3-5p	CLIP-seq
MIRT2469709	hsa-miR-509-5p	CLIP-seq
MIRT2469710	hsa-miR-510	CLIP-seq
MIRT2469711	hsa-miR-544b	CLIP-seq
MIRT2469712	hsa-miR-552	CLIP-seq
MIRT2469713	hsa-miR-590-3p	CLIP-seq
MIRT2469714	hsa-miR-603	CLIP-seq
MIRT2469715	hsa-miR-646	CLIP-seq
MIRT2469716	hsa-miR-653	CLIP-seq
MIRT766167	hsa-miR-1182	CLIP-seq
MIRT2469687	hsa-miR-1200	CLIP-seq
MIRT766168	hsa-miR-122	CLIP-seq
MIRT766169	hsa-miR-1227	CLIP-seq
MIRT2469688	hsa-miR-1245	CLIP-seq
MIRT2469689	hsa-miR-1245b-5p	CLIP-seq
MIRT766170	hsa-miR-193a-5p	CLIP-seq
MIRT2469690	hsa-miR-1976	CLIP-seq
MIRT766172	hsa-miR-3135b	CLIP-seq
MIRT2469691	hsa-miR-3142	CLIP-seq
MIRT2469692	hsa-miR-3155	CLIP-seq
MIRT2469693	hsa-miR-3155b	CLIP-seq
MIRT2469694	hsa-miR-3157-5p	CLIP-seq
MIRT766173	hsa-miR-3194-3p	CLIP-seq
MIRT2469695	hsa-miR-329	CLIP-seq
MIRT2469696	hsa-miR-3545-3p	CLIP-seq
MIRT2469697	hsa-miR-362-3p	CLIP-seq
MIRT766175	hsa-miR-3652	CLIP-seq
MIRT2469698	hsa-miR-370	CLIP-seq
MIRT2469699	hsa-miR-3941	CLIP-seq
MIRT2469700	hsa-miR-3977	CLIP-seq
MIRT766177	hsa-miR-431	CLIP-seq
MIRT2469701	hsa-miR-4324	CLIP-seq
MIRT2469702	hsa-miR-4418	CLIP-seq
MIRT766178	hsa-miR-4430	CLIP-seq
MIRT2469703	hsa-miR-4468	CLIP-seq
MIRT2469704	hsa-miR-4680-5p	CLIP-seq
MIRT766179	hsa-miR-4715-3p	CLIP-seq
MIRT2469707	hsa-miR-484	CLIP-seq
MIRT2469708	hsa-miR-509-3-5p	CLIP-seq
MIRT2469709	hsa-miR-509-5p	CLIP-seq
MIRT2469710	hsa-miR-510	CLIP-seq
MIRT2469711	hsa-miR-544b	CLIP-seq
MIRT2469712	hsa-miR-552	CLIP-seq
MIRT2469714	hsa-miR-603	CLIP-seq
MIRT2469715	hsa-miR-646	CLIP-seq
MIRT2469716	hsa-miR-653	CLIP-seq

Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004222	Function	Metalloendopeptidase activity	IBA
GO:0004222	Function	Metalloendopeptidase activity	IEA
GO:0004222	Function	Metalloendopeptidase activity	NAS	11814695
GO:0005515	Function	Protein binding	IPI	25416956
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	NAS	11814695
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008270	Function	Zinc ion binding	NAS	11814695
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	11814695
GO:0016787	Function	Hydrolase activity	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
607114	15478	ENSG00000149451

Q9BZ11

Protein name

Disintegrin and metalloproteinase domain-containing protein 33 (ADAM 33) (EC 3.4.24.-)

PDB

1R54 , 1R55

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01562	Pep_M12B_propep	39 → 167	Reprolysin family propeptide	Family
PF01421	Reprolysin	210 → 409	Reprolysin (M12B) family zinc metalloprotease	Domain
PF00200	Disintegrin	426 → 498	Disintegrin	Domain
PF08516	ADAM_CR	503 → 619	ADAM cysteine-rich	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in all tissues, except liver, with high expression in placenta, lung, spleen and veins. {ECO:0000269|PubMed:11814695}.

Sequence

MGWRPRRARGTPLLLLLLLLLLWPVPGAGVLQGHIPGQPVTPHWVLDGQPWRTVSLEEPV
SKPDMGLVALEAEGQELLLELEKNHRLLAPGYIETHYGPDGQPVVLAPNHTDHCHYQGRV
RGFPDSWVVLCTCSGMSGLITLSRNASYYLRPWPPRGSKDFSTHEIFRMEQLLTWKGTCG
HRDPGNKAGMTSLPGGPQSRGRREARRTRKYLELYIVADHTLFLTRHRNLNHTKQRLLEV
ANYVDQLLRTLDIQVALTGLEVWTERDRSRVTQDANATLWAFLQWRRGLWAQRPHDSAQL
LTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMAHEIGHSLGLSHDPDGC
CVEAAAESGGCVMAAATGHPFPRVFSACSRRQLRAFFRKGGGACLSNAPDPGLPVPPALC
GNGFVEAGEECDCGPGQECRDLCCFAHNCSLRPGAQCAHGDCCVRCLLKPAGALCRQAMG
DCDLPEFCTGTSSHCPPDVYLLDGSPCARGSGYCWDGACPTLEQQCQQLWGPGSHPAPEA
CFQVVNSAGDAHGNCGQDSEGHFLPCAGRDALCGKLQCQGGKPSLLAPHMVPVDSTVHLD
GQEVTCRGALALPSAQLDLLGLGLVEPGTQCGPRMVCQSRRCRKNAFQELQRCLTACHSH
GVCNSNHNCHCAPGWAPPFCDKPGFGGSMDSGPVQAENHDTFLLAMLLSVLLPLLPGAGL
AWCCYRLPGAHLQRCSWGCRRDPACSGPKDGPHRDHPLGGVHPMELGPTATGQPWPLDPE
NSHEPSSHPEKPLPAVSPDPQADQVQMPRSCLW

Sequence length

813

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHIAL HYPERREACTIVITY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHINITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (62)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	15298558, 18752037, 18778489, 22349453, 24035932, 24751681, 24908071, 26619918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	20227692, 23861802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	16519819	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	16519819	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	12110844, 12401189, 12768445, 12885268, 12958057, 14564349, 14720258, 14742294, 14764626, 15007338, 15144468, 15196271, 15208587, 15298558, 15347848 View all (92 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	12110844, 14564349, 15387895, 15709049, 16387804, 16799089, 17339047, 17640346		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	12401189, 16024651, 16784537, 17088949, 17640346, 17878941, 18560587, 18778489, 19317339, 19951440, 20003279, 20513247, 21103062, 22227561, 22660217 View all (24 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	20227692, 23861802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	23861802	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19267929, 28294120, 30226539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	30226539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19267929, 28294120	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	12110844, 12768445, 12885268, 14742294, 15347848, 15709049, 15953744, 16773130, 16784537, 16893396, 17339047, 18423563, 19236319, 19665773, 21930123		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchial Hyperreactivity	Bronchial Hyperreactivity	CTD_human_DG	17061022		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchial Hyperreactivity	Bronchial hyperreactivity	Pubtator	23640030	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchitis	Bronchitis	Pubtator	27624002	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	19267929	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	19267929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Castleman Disease	Castleman disease	Pubtator	34686774	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	15208587, 16650044, 16784537, 20395963, 21179102, 21930123, 25313536, 25768087, 28285393, 28876365, 31626088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	15879414, 17090574, 17403951, 20003279, 20156753, 21161400, 23861802, 23902466, 24191661, 24422987, 25158257, 25369941, 27323020, 31357020		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	20227692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	20227692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	24699314	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	20227692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	19146844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	19146844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	27624002	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	25840998	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23525950	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	16519819	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	19267929	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	24141861	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	24728305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	17878941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	17878941	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	16519819	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19267929, 28294120, 30226539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	30226539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19265133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	30226539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19267929, 28294120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	30226539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	30226539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	16519819	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	20537279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19267929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	32907841	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	17878941, 18560587, 18923449, 20491578, 22269827, 24562625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	17878941, 18560587	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	LHGDN	18560587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	17090574, 20003279, 20156753, 23861802, 24191661, 24253534, 25369941, 27323020, 34848800, 38345545	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	24728305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	BEFREE	18778489		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis	Rhinitis	Pubtator	18778489	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis Allergic	Rhinitis	Pubtator	18778489	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stage IV Skin Melanoma	Skin Melanoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19265133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	36977901	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28294120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	28294120	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Remodeling	Vascular remodeling	Pubtator	33982767	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ADAM33 (ADAM metallopeptidase domain 33)